STAC2 Antibody - #DF4500
| Product: | STAC2 Antibody |
| Catalog: | DF4500 |
| Description: | Rabbit polyclonal antibody to STAC2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 40 KD; 45kD(Calculated). |
| Uniprot: | Q6ZMT1 |
| RRID: | AB_2836851 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4500, RRID:AB_2836851.
Fold/Unfold
24b2; 24b2/STAC2; SH3 and cysteine rich domain 2; SH3 and cysteine rich domain containing protein 2; SH3 and cysteine-rich domain-containing protein 2; SRC homology 3 and cysteine rich domain protein 2; Src homology 3 and cysteine-rich domain-containing protein 2; STAC2; STAC2_HUMAN;
Immunogens
A synthesized peptide derived from human STAC2, corresponding to a region within the internal amino acids.
- Q6ZMT1 STAC2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLENFFLRSGSELKCPTEVLLTPPTPLPPPSPPPTASDRGLATPSPSPCPVPRPLAALKPVRLHSFQEHVFKRASPCELCHQLIVGNSKQGLRCKMCKVSVHLWCSEEISHQQCPGKTSTSFRRNFSSPLLVHEPPPVCATSKESPPTGDSGKVDPVYETLRYGTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQQLPKATLRKDVGPMYSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQPFSGNKEQGYMSLKENQICVGVGRSKDADGFIRVSSGKKRGLVPVDALTEI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Plays a redundant role in promoting the expression of calcium channel CACNA1S at the cell membrane, and thereby contributes to increased channel activity. Slows down the inactivation rate of the calcium channel CACNA1C.
Cytoplasm>Cytosol. Cell membrane>Peripheral membrane protein>Cytoplasmic side. Cell membrane>Sarcolemma>Peripheral membrane protein>Cytoplasmic side.
Note: Colocalizes with CACNA1C at the plasma membrane of transfected cells.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.