SCN2B Antibody - #DF4514
| Product: | SCN2B Antibody |
| Catalog: | DF4514 |
| Description: | Rabbit polyclonal antibody to SCN2B |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 24 KD; 24kD(Calculated). |
| Uniprot: | O60939 |
| RRID: | AB_2836865 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4514, RRID:AB_2836865.
Fold/Unfold
Neuronal voltage gated sodium channel beta 2 subunit; Scn 2b; Scn2b; SCN2B_HUMAN; Sodium channel beta 2 subunit; Sodium channel subunit beta 2; Sodium channel subunit beta-2; Sodium channel voltage gated type II beta; Sodium channel voltage gated type II beta polypeptide;
Immunogens
- O60939 SCN2B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O60939 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S156 | Phosphorylation | Uniprot | |
| T157 | Phosphorylation | Uniprot | |
| S165 | Phosphorylation | Uniprot | |
| S192 | Phosphorylation | Uniprot | |
| T204 | Phosphorylation | Uniprot |
Research Backgrounds
Crucial in the assembly, expression, and functional modulation of the heterotrimeric complex of the sodium channel. The subunit beta-2 causes an increase in the plasma membrane surface area and in its folding into microvilli. Interacts with TNR may play a crucial role in clustering and regulation of activity of sodium channels at nodes of Ranvier (By similarity).
Membrane>Single-pass type I membrane protein.
Brain specific.
The voltage-sensitive sodium channel consists of an ion conducting pore forming alpha-subunit (SCN2A) regulated by one or more beta subunits (SCN1B, SCN2B, SCN3B and SCN4B). SCN1B and SCN3B are non-covalently associated with SCN2A. SCN2B and SCN4B are disulfide-linked to SCN2A.
Belongs to the sodium channel auxiliary subunit SCN2B (TC 8.A.17) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.