TCEAL1 Antibody - #DF4570
| Product: | TCEAL1 Antibody |
| Catalog: | DF4570 |
| Description: | Rabbit polyclonal antibody to TCEAL1 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 20 KD; 18kD(Calculated). |
| Uniprot: | Q15170 |
| RRID: | AB_2836921 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4570, RRID:AB_2836921.
Fold/Unfold
Highly similar to gene pp21 protein [H.sapiens]; Nuclear phosphoprotein p21/SIIR; p21; pp21; SIIR; TCAL1_HUMAN; TCEA like protein 1; TCEA-like protein 1; TCEAL1; Transcription elongation factor A (SII) like 1; Transcription elongation factor A protein like 1; Transcription elongation factor A protein-like 1; Transcription elongation factor S II protein like 1; Transcription elongation factor S-II protein-like 1;
Immunogens
A synthesized peptide derived from human TCEAL1, corresponding to a region within the internal amino acids.
Expressed in all tissues examined. Highly expressed in heart, ovary, prostate and skeletal muscle. Moderately expressed in brain, placenta, testis and small intestine. Weakly expressed in lung, liver and spleen. Expressed in several cancer cell lines.
- Q15170 TCAL1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDKPRKENEEEPQSRPRPMRRGLRWSTLPKSSPPRSSLRRSSPRRRSSFLRSSCLSSCLRCSSRRTPSAGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
May be involved in transcriptional regulation. Modulates various viral and cellular promoters in a promoter context-dependent manner. For example, transcription from the FOS promoter is increased, while Rous sarcoma virus (RSV) long terminal repeat (LTR) promoter activity is repressed. Does not bind DNA directly.
Phosphorylation of Ser-36 and Ser-37 is critical for transcriptional repression.
Nucleus.
Expressed in all tissues examined. Highly expressed in heart, ovary, prostate and skeletal muscle. Moderately expressed in brain, placenta, testis and small intestine. Weakly expressed in lung, liver and spleen. Expressed in several cancer cell lines.
Belongs to the TFS-II family. TFA subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.