TCEAL6 Antibody - #DF4571
Product: | TCEAL6 Antibody |
Catalog: | DF4571 |
Description: | Rabbit polyclonal antibody to TCEAL6 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 25 KD; 22kD(Calculated). |
Uniprot: | Q6IPX3 |
RRID: | AB_2836922 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4571, RRID:AB_2836922.
Fold/Unfold
TCAL6_HUMAN; TCEA like protein 6; TCEA-like protein 6; Tceal3; TCEAL6; Transcription elongation factor A (SII) like 3; Transcription elongation factor A (SII) like 6; Transcription elongation factor A protein like 6; Transcription elongation factor A protein-like 6; Transcription elongation factor S II protein like 6; Transcription elongation factor S-II protein-like 6;
Immunogens
- Q6IPX3 TCAL6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDAEGKTECEGKRKAEGEPGDEGQLEDKGSQEKQGKSEGEGKPQGEGKPASQAKPEGQPRAAEKRPAGDYVPRKAKRKTDRGTDDSPKDSQEDLQERHLSSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQRGLHDIPYL
PTMs - Q6IPX3 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K71 | Acetylation | Uniprot | |
T118 | Phosphorylation | Uniprot | |
S121 | Phosphorylation | Uniprot | |
S125 | Phosphorylation | Uniprot | |
S135 | Phosphorylation | Uniprot | |
K158 | Methylation | Uniprot | |
R176 | Methylation | Uniprot | |
R179 | Methylation | Uniprot |
Research Backgrounds
May be involved in transcriptional regulation.
Nucleus.
Belongs to the TFS-II family. TFA subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.