SLC39A1 Antibody - #DF4637
Product: | SLC39A1 Antibody |
Catalog: | DF4637 |
Description: | Rabbit polyclonal antibody to SLC39A1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 38 KD; 34kD(Calculated). |
Uniprot: | Q9NY26 |
RRID: | AB_2836928 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4637, RRID:AB_2836928.
Fold/Unfold
hZIP1; IRT1; S39A1_HUMAN; SLC39A1; Solute carrier family 39 member 1; Zinc transporter ZIP1; Zinc-iron-regulated transporter-like; ZIP-1; ZIP1; ZIRTL; Zrt- and Irt-like protein 1;
Immunogens
- Q9NY26 S39A1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGPWGEPELLVWRPEAVASEPPVPVGLEVKLGALVLLLVLTLLCSLVPICVLRRPGANHEGSASRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGAALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALLTGLLFIQI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Mediates zinc uptake. May function as a major endogenous zinc uptake transporter in many cells of the body. Responsible for the rapid uptake and accumulation of physiologically effective zinc in prostate cells.
Cell membrane>Multi-pass membrane protein. Endoplasmic reticulum membrane>Multi-pass membrane protein.
Note: Shows a vesicular localization corresponding partially to the endoplasmic reticulum in several epithelial cell lines.
Ubiquitous. Expressed in most adult and fetal tissues including the epidermis.
Belongs to the ZIP transporter (TC 2.A.5) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.