MTIF3 Antibody - #DF4579
Product: | MTIF3 Antibody |
Catalog: | DF4579 |
Description: | Rabbit polyclonal antibody to MTIF3 |
Application: | WB IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 30 KD; 32kD(Calculated). |
Uniprot: | Q9H2K0 |
RRID: | AB_2836943 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4579, RRID:AB_2836943.
Fold/Unfold
DC38; IF 3; IF 3Mt; IF-3(Mt); IF-3Mt; IF3; IF3(mt); IF3M_HUMAN; IF3mt; mitochondrial; Mt; MTIF3; Translation initiation factor IF 3, mitochondrial precursor; Translation initiation factor IF-3;
Immunogens
- Q9H2K0 IF3M_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
PTMs - Q9H2K0 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T61 | Phosphorylation | Uniprot |
Research Backgrounds
IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.
Mitochondrion.
Belongs to the IF-3 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.