UBE2D2 Antibody - #DF4600
| Product: | UBE2D2 Antibody | 
| Catalog: | DF4600 | 
| Description: | Rabbit polyclonal antibody to UBE2D2 | 
| Application: | WB IF/ICC | 
| Reactivity: | Human, Mouse, Rat | 
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus | 
| Mol.Wt.: | 17 KD; 17kD(Calculated). | 
| Uniprot: | P62837 | 
| RRID: | AB_2836964 | 
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4600, RRID:AB_2836964.
Fold/Unfold
E2(17)KB2; OTTHUMP00000223475; OTTHUMP00000223476; OTTHUMP00000223477; OTTHUMP00000223478; OTTHUMP00000224375; PUBC 1; PUBC1; UB2D2_HUMAN; UBC 4; UBC 4/5; UBC4; UBC4/5; UBC4/5 homolog yeast; UBCH 5B; UBCH5B; UBE2D2; Ubiquitin carrier protein; Ubiquitin carrier protein D2; Ubiquitin conjugating enzyme E2 17 kDa 2; Ubiquitin conjugating enzyme E2 D2; Ubiquitin conjugating enzyme E2D 2 (homologous to yeast UBC4/5); Ubiquitin conjugating enzyme E2D 2 (UBC4/5 homolog yeast); Ubiquitin conjugating enzyme E2D 2; Ubiquitin protein ligase D2; Ubiquitin-conjugating enzyme E2 D2; Ubiquitin-conjugating enzyme E2(17)KB 2; Ubiquitin-conjugating enzyme E2-17 kDa 2; Ubiquitin-protein ligase D2;
Immunogens
A synthesized peptide derived from human UBE2D2, corresponding to a region within C-terminal amino acids.
- P62837 UB2D2_HUMAN:
 - Protein BLAST With
 - NCBI/
 - ExPASy/
 - Uniprot
 
MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and autoubiquitination of STUB1 and TRAF6. Involved in the signal-induced conjugation and subsequent degradation of NFKBIA, FBXW2-mediated GCM1 ubiquitination and degradation, MDM2-dependent degradation of p53/TP53 and the activation of MAVS in the mitochondria by DDX58/RIG-I in response to viral infection. Essential for viral activation of IRF3.
Belongs to the ubiquitin-conjugating enzyme family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Shigellosis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.