UEVLD Antibody - #DF4602
| Product: | UEVLD Antibody |
| Catalog: | DF4602 |
| Description: | Rabbit polyclonal antibody to UEVLD |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Prediction: | Rat, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 52 KD; 52kD(Calculated). |
| Uniprot: | Q8IX04 |
| RRID: | AB_2836966 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4602, RRID:AB_2836966.
Fold/Unfold
8430408E05Rik; ATTP; EV and lactate malate dehydrogenase domain containing protein; EV and lactate/malate dehydrogenase domain-containing protein; FLJ11068; signaling molecule ATTP; ubiquitin conjugating enzyme E2 like; Ubiquitin conjugating enzyme E2 variant 3; Ubiquitin E2 variant and lactate/malate dehydrogenase domain containing protein; Ubiquitin-conjugating enzyme E2 variant 3; UEV 3; UEV and lactate malate dehyrogenase domains; UEV-3; UEV2 and LDH domains containing protein; UEV3; uevld; UEVLD_HUMAN;
Immunogens
A synthesized peptide derived from human UEVLD, corresponding to a region within N-terminal amino acids.
Colon, colon carcinoma cell lines, normal cervical epithelium, carcinomas of the uterine cervix and peripheral blood leukocytes.
- Q8IX04 UEVLD_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEFDCEGLRRLLGKYKFRDLTVEELRNVNVFFPHFKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAPPICFLKPTANMGILVGKHVDAQGRIYLPYLQNWSHPKSVIVGLIKEMIAKFQEELPMYSLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNSLGSSQSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSEVIKTTLKEDTVTEKLQSSASSIHSLQQQLKL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Possible negative regulator of polyubiquitination.
Colon, colon carcinoma cell lines, normal cervical epithelium, carcinomas of the uterine cervix and peripheral blood leukocytes.
In the N-terminal section; belongs to the ubiquitin-conjugating enzyme family. UEV subfamily.
In the C-terminal section; belongs to the LDH/MDH superfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.