ZFYVE19 Antibody - #DF4625
Product: | ZFYVE19 Antibody |
Catalog: | DF4625 |
Description: | Rabbit polyclonal antibody to ZFYVE19 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Horse, Rabbit, Dog |
Mol.Wt.: | 50 KD; 52kD(Calculated). |
Uniprot: | Q96K21 |
RRID: | AB_2836989 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4625, RRID:AB_2836989.
Fold/Unfold
Abscission/NoCut checkpoint regulator; ANCHR; MLL partner containing FYVE domain; MPFYVE; ZFY19_HUMAN; ZFYVE 19; Zfyve19; Zinc finger FYVE domain containing protein 19; Zinc finger FYVE domain-containing protein 19; Zinc finger FYVE type containing 19; Zinc finger, FYVE domain containing 19;
Immunogens
- Q96K21 ANCHR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNYDSQQPPLPPLPYAGCRRASGFPALGRGGTVPVGVWGGAGQGREGRSWGEGPRGPGLGRRDLSSADPAVLGATMESRCYGCAVKFTLFKKEYGCKNCGRAFCSGCLSFSAAVPRTGNTQQKVCKQCHEVLTRGSSANASKWSPPQNYKKRVAALEAKQKPSTSQSQGLTRQDQMIAERLARLRQENKPKLVPSQAEIEARLAALKDERQGSIPSTQEMEARLAALQGRVLPSQTPQPAHHTPDTRTQAQQTQDLLTQLAAEVAIDESWKGGGPAASLQNDLNQGGPGSTNSKRQANWSLEEEKSRLLAEAALELREENTRQERILALAKRLAMLRGQDPERVTLQDYRLPDSDDDEDEETAIQRVLQQLTEEASLDEASGFNIPAEQASRPWTQPRGAEPEAQDVDPRPEAEEEELPWCCICNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96K21 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y3 | Phosphorylation | Uniprot | |
S5 | Phosphorylation | Uniprot | |
Y15 | Phosphorylation | Uniprot | |
S22 | Phosphorylation | Uniprot | |
S105 | Phosphorylation | Uniprot | |
K126 | Ubiquitination | Uniprot | |
S141 | Phosphorylation | Uniprot | |
S144 | Phosphorylation | Uniprot | |
K159 | Ubiquitination | Uniprot | |
K161 | Ubiquitination | Uniprot | |
K207 | Sumoylation | Uniprot | |
K207 | Ubiquitination | Uniprot | |
S213 | Phosphorylation | Uniprot | |
S216 | Phosphorylation | Uniprot | |
T217 | Phosphorylation | Uniprot | |
T236 | Phosphorylation | Uniprot | |
T243 | Phosphorylation | Uniprot | |
S278 | Phosphorylation | Uniprot | |
S290 | Phosphorylation | Uniprot | |
S293 | Phosphorylation | Uniprot | |
K294 | Ubiquitination | Uniprot | |
S300 | Phosphorylation | Uniprot | |
K305 | Ubiquitination | Uniprot | |
K331 | Ubiquitination | Uniprot | |
T345 | Phosphorylation | Uniprot | |
Y349 | Phosphorylation | Uniprot | |
S354 | Phosphorylation | Uniprot | |
S376 | Phosphorylation | Uniprot | |
T459 | Phosphorylation | Uniprot | |
S460 | Phosphorylation | Uniprot | |
S463 | Phosphorylation | Uniprot |
Research Backgrounds
Key regulator of abscission step in cytokinesis: part of the cytokinesis checkpoint, a process required to delay abscission to prevent both premature resolution of intercellular chromosome bridges and accumulation of DNA damage. Together with CHMP4C, required to retain abscission-competent VPS4 (VPS4A and/or VPS4B) at the midbody ring until abscission checkpoint signaling is terminated at late cytokinesis. Deactivation of AURKB results in dephosphorylation of CHMP4C followed by its dissociation from ZFYVE19/ANCHR and VPS4 and subsequent abscission.
Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cleavage furrow. Midbody>Midbody ring.
Note: Localizes mainly on centrosomes in interphase and early mitosis. Localizes at the cleavage furrow and midbody ring in late mitosis and cytokinesis.
Detected in brain, heart, skeletal muscle, kidney and liver.
Interacts (via MIM1-B) with VPS4A; interaction takes place at the midbody ring following cytokinesis checkpoint activation.
The FYVE-type zinc finger mediates binding to phosphatidylinositol-3-phosphate (PtdIns(3)P).
The MIM1-B motif mediates interaction with VPS4A.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.