Product: TAZ Antibody
Catalog: DF4653
Description: Rabbit polyclonal antibody to TAZ
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 43 KD, 53 kDa(Observed); 33kD(Calculated).
Uniprot: Q16635
RRID: AB_2837004

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Polyclonal
Specificity:
TAZ Antibody detects endogenous levels of total TAZ.
RRID:
AB_2837004
Cite Format: Affinity Biosciences Cat# DF4653, RRID:AB_2837004.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Barth syndrome; Cardiomyopathy dilated 3A (X linked); EFE2; Endocardial fibroelastosis 2; Protein G4.5; Tafazzin; TAZ; TAZ protein; TAZ_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human TAZ, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q16635 TAZ_HUMAN:

High levels in cardiac and skeletal muscle. Up to 10 isoforms can be present in different amounts in different tissues. Most isoforms are ubiquitous. Isoforms that lack the N-terminus are found in leukocytes and fibroblasts, but not in heart and skeletal muscle. Some forms appear restricted to cardiac and skeletal muscle or to leukocytes.

Sequence:
MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTKYMNHLTVHNREVLYELIEKRGPATPLITVSNHQSCMDDPHLWGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGAEFFQAENEGKGVLDTGRHMPGAGKRREKGDGVYQKGMDFILEKLNHGDWVHIFPEGKVNMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR

Research Backgrounds

Function:

Some isoforms may be involved in cardiolipin (CL) metabolism.

Subcellular Location:

Membrane>Single-pass membrane protein.

Cytoplasm.

Membrane>Single-pass membrane protein.

Membrane>Single-pass membrane protein.

Membrane>Single-pass membrane protein.

Cytoplasm.

Membrane>Single-pass membrane protein.

Cytoplasm.

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

High levels in cardiac and skeletal muscle. Up to 10 isoforms can be present in different amounts in different tissues. Most isoforms are ubiquitous. Isoforms that lack the N-terminus are found in leukocytes and fibroblasts, but not in heart and skeletal muscle. Some forms appear restricted to cardiac and skeletal muscle or to leukocytes.

Family&Domains:

The hydrophilic domain may serve as an exposed loop interacting with other proteins.

Belongs to the taffazin family.

Research Fields

· Metabolism > Lipid metabolism > Glycerophospholipid metabolism.

References

1). An H2 S-BMP6 Dual-Loading System with Regulating Yap/Taz and Jun Pathway for Synergistic Critical Limb Ischemia Salvaging Therapy. Advanced healthcare materials, 2023 (PubMed: 37531238) [IF=10.0]

2). Wuweixiaoduyin regulates TAZ-mediated immunoregulatory properties of Treg/TH17 cells in chronic osteomyelitis. Biotechnology & genetic engineering reviews, 2023 (PubMed: 36641597) [IF=6.5]

3). YAP signaling in horizontal basal cells promotes the regeneration of olfactory epithelium after injury. Stem cell reports, 2022 (PubMed: 35148842) [IF=5.9]

Application: WB    Species: Mouse    Sample:

Figure 1 YAP is upregulated and activated in HBCs after acute OE injury (A–D) Double immunostaining of YAP (green) and p63 (red) (A), YAP (green) and LSD1 (red) (B), YAP (green) and GAP43 (red) (C), and YAP (green) and OMP (red) (D) in the OE of 2-month-old C57BL/6 mice. (E) Western blot detected the expression of p-YAP and YAP in the OE of 2-month-old C57BL/6 mice at 0, 3, 5, 7, and 14 dpl. (F and G) Quantitative analysis of the relative p-YAP/YAP (F) and YAP (G) levels as shown in (E) (n = 8 blots from 4 mice per group, normalized to the 0 dpl group). (H) Western blot detected the expression of TAZ in the OE of 2-month-old C57BL/6 mice at 0, 3, 5, 7, and 14 dpl. (I) Quantitative analysis of the relative TAZ level as shown in (H) (n = 15 blots from 5 mice per group, normalized to the 0 dpl group). (J) Immunohistochemistry detected the expression of YAP in the OE of 2-month-old C57BL/6 mice at 0, 3, 7, and 14 dpl. (K) Quantitative analysis of the relative YAP density as shown in (J) (n = 10 sections from 5 mice per group). (L) Double immunostaining of YAP (green) and p63 (red) in the OE of 2-month-old C57BL/6 mice at 0, 2, 5, and 14 dpl. (M) Quantitative analysis of the percentage of both YAP+ and p63+ cells over p63+ cells as shown in (L) (n = 9 sections from 3 mice per group). Images of selected regions are shown at higher magnification. Data are mean ± SEM, one-way ANOVA with Bonferroni’s post tests, compared with 0 dpl group; ∗p < 0.05, ∗∗p < 0.01, ∗∗∗p < 0.001. Scale bars, 20 μm.

4). TAZ Induces Migration of Microglia and Promotes Neurological Recovery After Spinal Cord Injury. Frontiers in pharmacology, 2022 (PubMed: 35833021) [IF=5.6]

Application: WB    Species: Mouse    Sample: spinal cords

FIGURE 1. TAZ was significantly increased and localized in microglia. (A) Western blot analysis of TAZ expression in spinal cords at 3d, 7d, 14d, and 28d after SCI, compared with Pre (pre-operation, Pre). (B) Quantitative analysis of TAZ level as shown in (A). The blots (n = 3 per group) were quantified by a densitometric method using ImageJ software. GAPDH was used as the loading control. Data were mean ± SEM. *p

5). Protecting mitochondria via inhibiting VDAC1 oligomerization alleviates ferroptosis in acetaminophen-induced acute liver injury. Cell biology and toxicology, 2022 (PubMed: 34401974) [IF=5.3]

6). Sweroside ameliorates intestinal mucosal microcirculatory disturbances in ulcerative colitis mice by modulating the VEGF and Hippo signaling pathways. International immunopharmacology, 2025 (PubMed: 40836408) [IF=4.8]

7). Manganese drives ferroptosis of cancer cells via YAP/TAZ phase separation activated ACSL4 in OSCC. Oral diseases, 2024 (PubMed: 38462885) [IF=2.9]

8). Icariin regulates the Hippo/TAZ signaling pathway to promote osteogenic differentiation and bone remodeling in osteoporosis. Biochemical and biophysical research communications, 2025 (PubMed: 41264994) [IF=2.5]

Application: WB    Species: Rat    Sample: BMSCs

Fig. 3. Effect of ICA on Hippo signaling pathway in BMSCs (A- B) Relative mRNA expression levels of MST1 and TAZ (n = 3); (C–G) Relative protein expression levels of MST1, p-MST1, TAZ and p-TAZ (n = 3).

9). Gallic acid from Terminalia chebula inhibited the growth of esophageal carcinoma cells by suppressing the Hippo signal pathway. Iranian Journal of Basic Medical Sciences, 2020 (PubMed: 33235697) [IF=2.1]

Application: WB    Species: human    Sample: EC9706 and KYSE450 cells

Figure 6. Effect of different concentrations (10, 20, and 40 μg/ml) of GA on the Hippo signal pathway in EC9706 and KYSE450 cells by Western blotting assay

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.