Product: LAL Antibody
Catalog: BF0079
Description: Mouse monoclonal antibody to LAL
Application: WB ELISA
Cited expt.: WB
Reactivity: Human
Mol.Wt.: 46kDa; 45kD(Calculated).
Uniprot: P38571
RRID: AB_2833297

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
ELISA 1:10000, WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFB1272]
Specificity:
LAL antibody detects endogenous levels of total LAL.
RRID:
AB_2833297
Cite Format: Affinity Biosciences Cat# BF0079, RRID:AB_2833297.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Acid cholesteryl ester hydrolase; CESD; cholesterol ester hydrolase; cholesterol ester storage disease; Cholesteryl esterase; Hydrolase deficiency; LAL; LAL deficiency cholesterol ester; LICH_HUMAN; lipA; LIPA deficiency; Lipase A; lipase A, lysosomal acid, cholesterol esterase; lysosomal acid lipase; lysosomal acid lipase deficiency; Lysosomal acid lipase/cholesteryl ester hydrolase; Sterol esterase;

Immunogens

Immunogen:

Purified recombinant fragment of human LAL expressed in E. Coli.

Uniprot:
Gene(ID):
Description:
Lysosomal acid lipase (LAL), with 378-amino acid protein( 43-54 kDa), functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides which are taken up by receptor-mediated endocytosis. An inherited deficiency or low activity of human lysosomal acid lipase results in the intralysosomal storage of the respective lipid substrates.
Sequence:
MKMRFLGLVVCLVLWTLHSEGSGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ

Research Backgrounds

Function:

Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation.

Subcellular Location:

Lysosome.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the AB hydrolase superfamily. Lipase family.

Research Fields

· Cellular Processes > Transport and catabolism > Lysosome.   (View pathway)

· Metabolism > Lipid metabolism > Steroid biosynthesis.

· Organismal Systems > Digestive system > Cholesterol metabolism.

References

1). Cholesterol-rich lysosomes induced by respiratory syncytial virus promote viral replication by blocking autophagy flux. Nature communications, 2024 (PubMed: 39060258) [IF=16.6]

Application: WB    Species: Human    Sample: HEp-2 cells

Fig. 2. RSV infection blocks cholesterol egress from lysosomes by reducing LAL activity. HEp-2 cells were either mock-infected or infected with RSV (MOI = 1) in the presence or absence of orlistat (10 μM) for the indicated durations. a, b The activity of LAL in HEp-2 cells 24 h after RSV infection was determined using flow cytometry (n = 3 independent experiments). c The mRNA level of LAL gene in HEp-2 cells 12 h or 24 h after RSV infection was determined using RT-PCR (n = 3 independent experiments). d, e Western blotting analysis of LAL in HEp-2 cells 12 h or 24 h after RSV infection (n = 3 independent experiments). Data are shown as the mean ± SD, statistical analysis using two-sided Student’s t-test (c, e) or one-way ANOVA (b) (**P 

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.