FGFP2 Antibody - #DF4700
Product: | FGFP2 Antibody |
Catalog: | DF4700 |
Description: | Rabbit polyclonal antibody to FGFP2 |
Application: | WB IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 37 KD; 25kD(Calculated). |
Uniprot: | Q9BYJ0 |
RRID: | AB_2837051 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4700, RRID:AB_2837051.
Fold/Unfold
37 kDa killer-specific secretory protein; FGF-binding protein 2; FGF-BP2; FGFBP-2; FGFBP2; FGFP2_HUMAN; Fibroblast growth factor-binding protein 2; HBp17-related protein; HBp17-RP; Ksp37;
Immunogens
A synthesized peptide derived from human FGFP2, corresponding to a region within C-terminal amino acids.
Expressed in serum, peripheral leukocytes and cytotoxic T-lymphocytes, but not in granulocytes and monocytes (at protein level).
- Q9BYJ0 FGFP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRG
Research Backgrounds
Secreted>Extracellular space.
Expressed in serum, peripheral leukocytes and cytotoxic T-lymphocytes, but not in granulocytes and monocytes (at protein level).
Belongs to the fibroblast growth factor-binding protein family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.