IL18BP Antibody - #DF4709
Product: | IL18BP Antibody |
Catalog: | DF4709 |
Description: | Rabbit polyclonal antibody to IL18BP |
Application: | WB IF/ICC |
Reactivity: | Human, Rat |
Mol.Wt.: | 44 KD; 21kD(Calculated). |
Uniprot: | O95998 |
RRID: | AB_2837060 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4709, RRID:AB_2837060.
Fold/Unfold
I18BP_HUMAN; IL-18BP; IL18 BP; IL18 BPa; IL18BP; IL18BPa; Interleukin 18 binding protein; Interleukin-18-binding protein; MC51L 53L 54L homolog gene product; Tadekinig alfa; Tadekinig-alfa;
Immunogens
A synthesized peptide derived from human IL18BP, corresponding to a region within C-terminal amino acids.
- O95998 I18BP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTMRHNWTPDLSPLWVLLLCAHVVTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
Research Backgrounds
Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.
N- and O-glycosylated. O-glycosylated with core 1-like and core 2-like glycans. O-glycan heterogeneity at Ser-53: HexHexNAc (major) and Hex2HexNAc2 (minor). N-glycan heterogeneity at Asn-103: Hex5HexNAc4 (minor), dHex1Hex5HexNAc4 (major) and Hex6HexNAc5 (minor); N-glycan at Asn-147: dHex1Hex5HexNAc4.
Secreted.
Strongly expressed in heart, lung, placenta and spleen.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.