TAIP-12 Antibody - #DF4725
Product: | TAIP-12 Antibody |
Catalog: | DF4725 |
Description: | Rabbit polyclonal antibody to TAIP-12 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 60 KD; 60kD(Calculated). |
Uniprot: | Q9H175 |
RRID: | AB_2837076 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4725, RRID:AB_2837076.
Fold/Unfold
C12ORF22; Chromosome 12 open reading frame 22; CSRN2_HUMAN; CSRNP-2; CSRNP2; Cysteine serine rich nuclear protein 2; Cysteine/serine-rich nuclear protein 2; Family with sequence similarity 130, member A1; Protein FAM130A1; TAIP-12; TAIP12; TGF beta induced apoptosis protein 12; TGF-beta-induced apoptosis protein 12;
Immunogens
A synthesized peptide derived from human TAIP-12, corresponding to a region within the internal amino acids.
- Q9H175 CSRN2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDAFTGSGLKRKFDDVDVGSSVSNSDDEISSSDSADSCDSLNPPTTASFTPTSILKRQKQLRRKNVRFDQVTVYYFARRQGFTSVPSQGGSSLGMAQRHNSVRSYTLCEFAQEQEVNHREILREHLKEEKLHAKKMKLTKNGTVESVEADGLTLDDVSDEDIDVENVEVDDYFFLQPLPTKRRRALLRASGVHRIDAEEKQELRAIRLSREECGCDCRLYCDPEACACSQAGIKCQVDRMSFPCGCSRDGCGNMAGRIEFNPIRVRTHYLHTIMKLELESKRQVSRPAAPDEEPSPTASCSLTGAQGSETQDFQEFIAENETAVMHLQSAEELERLKAEEDSSGSSASLDSSIESLGVCILEEPLAVPEELCPGLTAPILIQAQLPPGSSVLCFTENSDHPTASTVNSPSYLNSGPLVYYQVEQRPVLGVKGEPGTEEGSASFPKEKDLNVFSLPVTSLVACSSTDPAALCKSEVGKTPTLEALLPEDCNPEEPENEDFHPSWSPSSLPFRTDNEEGCGMVKTSQQNEDRPPEDSSLELPLAV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Binds to the consensus sequence 5'-AGAGTG-3' and has transcriptional activator activity (By similarity). May play a role in apoptosis.
Nucleus.
Belongs to the AXUD1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.