CD300LG Antibody - #DF4814
| Product: | CD300LG Antibody |
| Catalog: | DF4814 |
| Description: | Rabbit polyclonal antibody to CD300LG |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 36 KD; 36kD(Calculated). |
| Uniprot: | Q6UXG3 |
| RRID: | AB_2837165 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4814, RRID:AB_2837165.
Fold/Unfold
CD300 antigen-like family member G; CD300 molecule like family member g; CD300g; Cd300lg; CLM-9; CLM9; CLM9_HUMAN; CMRF35-like molecule 9; Nepmucin; TREM-4; TREM4; Triggering receptor expressed on myeloid cells 4;
Immunogens
A synthesized peptide derived from human CD300LG, corresponding to a region within the internal amino acids.
- Q6UXG3 CLM9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRLLVLLWGCLLLPGYEALEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPGPCCPPSPSPTFQPLATTRLQPKAKAQQTQPPGLTSPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLDSTSAEDTSPALSSGSSKPRVSIPMVRILAPVLVLLSLLSAAGLIAFCSHLLLWRKEAQQATETQRNEKFCLSRLTAEEKEAPSQAPEGDVISMPPLHTSEEELGFSKFVSA
Research Backgrounds
Receptor which may mediate L-selectin-dependent lymphocyte rollings. Binds SELL in a calcium dependent manner. Binds lymphocyte (By similarity).
O-glycosylated with sialylated oligosaccharides.
Apical cell membrane>Single-pass type I membrane protein. Basolateral cell membrane>Single-pass type I membrane protein. Endosome>Multivesicular body membrane>Single-pass type I membrane protein.
Note: Transcytoses across the cytoplasm.
Highly expressed in heart, skeletal muscle and placenta.
Ig-like V-type domain mediates binding to lymphocyte.
Belongs to the CD300 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.