BRS3 Antibody - #DF4855
Product: | BRS3 Antibody |
Catalog: | DF4855 |
Description: | Rabbit polyclonal antibody to BRS3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Prediction: | Pig, Rabbit |
Mol.Wt.: | 44 KD; 44kD(Calculated). |
Uniprot: | P32247 |
RRID: | AB_2837219 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4855, RRID:AB_2837219.
Fold/Unfold
BB3; BLP receptor subtype 3; Bombesin like receptor 3; Bombesin receptor subtype 3; Bombesin receptor subtype-3; BRS 3; BRS-3; BRS3; BRS3_HUMAN;
Immunogens
A synthesized peptide derived from human BRS3, corresponding to a region within the internal amino acids.
- P32247 BRS3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISVGILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGCKVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFALPEAIFSNVYTFRDPNKNMTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLIARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQTYVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADTSLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Role in sperm cell division, maturation, or function. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Cell membrane>Multi-pass membrane protein.
In germ cells in testis. Lung carcinoma cells.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.