Product: CCR7 Antibody
Catalog: DF4856
Description: Rabbit polyclonal antibody to CCR7
Application: WB IF/ICC
Reactivity: Human, Rat
Mol.Wt.: 43 KD; 43kD(Calculated).
Uniprot: P32248
RRID: AB_2837220

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Clonality:
Polyclonal
Specificity:
CCR7 Antibody detects endogenous levels of total CCR7.
RRID:
AB_2837220
Cite Format: Affinity Biosciences Cat# DF4856, RRID:AB_2837220.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BLR 2; BLR2; C C chemokine receptor type 7; C C CKR 7; C-C chemokine receptor type 7; C-C CKR-7; CC chemokine receptor 7; CC chemokine receptor type 7; CC CKR 7; CC-CKR-7; CCCKR7; CCR 7; CCR-7; Ccr7; CCR7_HUMAN; CD 197; CD197; CD197 antigen; CDw197; Chemokine (C C motif) receptor 7; Chemokine (C C) receptor 7; Chemokine C C motif receptor 7; Chemokine C C receptor 7; Chemokine receptor 7; Chemokine receptor 7-like protein; CMKBR7; EBI 1; EBI1; Ebi1h; EBV Induced G Protein Coupled Receptor 1; EBV-induced G-protein coupled receptor 1; Epstein Barr virus induced G protein coupled receptor; Epstein Barr virus induced gene 1; Epstein-Barr virus-induced G-protein coupled receptor 1; EVI 1; EVI1; Lymphocyte Specific G Protein Coupled Peptide Receptor; MGC108519; MIP 3 beta receptor; MIP-3 beta receptor; MIP3 Beta Receptor;

Immunogens

Immunogen:

A synthesized peptide derived from human CCR7, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P32248 CCR7_HUMAN:

Expressed in various lymphoid tissues and activated B- and T-lymphocytes, strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.

Sequence:
MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP

Research Backgrounds

Function:

Receptor for the MIP-3-beta chemokine. Probable mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in various lymphoid tissues and activated B- and T-lymphocytes, strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.

Family&Domains:

Belongs to the G-protein coupled receptor 1 family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.