EMR3 Antibody - #DF4876
| Product: | EMR3 Antibody |
| Catalog: | DF4876 |
| Description: | Rabbit polyclonal antibody to EMR3 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 70 KD; 73kD(Calculated). |
| Uniprot: | Q9BY15 |
| RRID: | AB_2837239 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4876, RRID:AB_2837239.
Fold/Unfold
Egf like module containing mucin like hormone receptor like 3; Egf like module containing mucin like receptor 3; EGF like module containing mucin like receptor EMR3; EMR 3;
Immunogens
A synthesized peptide derived from human EMR3, corresponding to a region within C-terminal amino acids.
Displays a predominantly leukocyte-restricted expression, with highest levels in neutrophils, monocytes and macrophages.
- Q9BY15 AGRE3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQGPLLLPGLCFLLSLFGAVTQKTKTSCAKCPPNASCVNNTHCTCNHGYTSGSGQKLFTFPLETCNDINECTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLHSGNEQFSNSNENTCQDTTSSKTTEGRKELQKIVDKFESLLTNQTLWRTEGRQEISSTATTILRDVESKVLETALKDPEQKVLKIQNDSVAIETQAITDNCSEERKTFNLNVQMNSMDIRCSDIIQGDTQGPSAIAFISYSSLGNIINATFFEEMDKKDQVYLNSQVVSAAIGPKRNVSLSKSVTLTFQHVKMTPSTKKVFCVYWKSTGQGSQWSRDGCFLIHVNKSHTMCNCSHLSSFAVLMALTSQEEDPVLTVITYVGLSVSLLCLLLAALTFLLCKAIRNTSTSLHLQLSLCLFLAHLLFLVGIDRTEPKVLCSIIAGALHYLYLAAFTWMLLEGVHLFLTARNLTVVNYSSINRLMKWIMFPVGYGVPAVTVAISAASWPHLYGTADRCWLHLDQGFMWSFLGPVCAIFSANLVLFILVFWILKRKLSSLNSEVSTIQNTRMLAFKATAQLFILGCTWCLGLLQVGPAAQVMAYLFTIINSLQGFFIFLVYCLLSQQVQKQYQKWFREIVKSKSESETYTLSSKMGPDSKPSEGDVFPGQVKRKY
Research Backgrounds
Orphan receptor that may play a role myeloid-myeloid interactions during immune and inflammatory responses. A ligand for the soluble form of this receptor is present at the surface of monocytes-derived macrophages and activated neutrophils.
Proteolytically cleaved into 2 subunits, an extracellular alpha subunit and a seven-transmembrane subunit.
Cell membrane>Multi-pass membrane protein.
Secreted.
Displays a predominantly leukocyte-restricted expression, with highest levels in neutrophils, monocytes and macrophages.
Belongs to the G-protein coupled receptor 2 family. Adhesion G-protein coupled receptor (ADGR) subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.