OPN3 Antibody - #DF4877
| Product: | OPN3 Antibody |
| Catalog: | DF4877 |
| Description: | Rabbit polyclonal antibody to OPN3 |
| Application: | WB IHC IF/ICC |
| Cited expt.: | WB, IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Horse, Rabbit, Dog |
| Mol.Wt.: | 45 KD; 45kD(Calculated). |
| Uniprot: | Q9H1Y3 |
| RRID: | AB_2837240 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4877, RRID:AB_2837240.
Fold/Unfold
ECPN; Encephalopsin; ERO; NMO 1; NMO1; OPN 3; Opn3; OPN3_HUMAN; Opsin 3; Opsin-3; Opsin3; Panopsin;
Immunogens
A synthesized peptide derived from human OPN3, corresponding to a region within the internal amino acids.
Strongly expressed in brain. Highly expressed in the preoptic area and paraventricular nucleus of the hypothalamus. Shows highly patterned expression in other regions of the brain, being enriched in selected regions of the cerebral cortex, cerebellar Purkinje cells, a subset of striatal neurons, selected thalamic nuclei, and a subset of interneurons in the ventral horn of the spinal cord.
- Q9H1Y3 OPN3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
May play a role in encephalic photoreception.
Membrane>Multi-pass membrane protein.
Strongly expressed in brain. Highly expressed in the preoptic area and paraventricular nucleus of the hypothalamus. Shows highly patterned expression in other regions of the brain, being enriched in selected regions of the cerebral cortex, cerebellar Purkinje cells, a subset of striatal neurons, selected thalamic nuclei, and a subset of interneurons in the ventral horn of the spinal cord.
Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.
References
Application: WB Species: Human Sample: HEK
Application: IF/ICC Species: Human Sample: HEK
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.