MC2R Antibody - #DF4909
| Product: | MC2R Antibody |
| Catalog: | DF4909 |
| Description: | Rabbit polyclonal antibody to MC2R |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Bovine, Horse, Sheep, Dog |
| Mol.Wt.: | 34 KD; 34kD(Calculated). |
| Uniprot: | Q01718 |
| RRID: | AB_2837262 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4909, RRID:AB_2837262.
Fold/Unfold
ACTH receptor; ACTH-R; ACTHR; ACTHR_HUMAN; Adrenocorticotropic hormone receptor; Adrenocorticotropin receptor; Corticotropin receptor; MC2 receptor; MC2-R; MC2R; Melanocortin 2 receptor (adrenocorticotropic hormone); Melanocortin 2 receptor; Melanocortin receptor 2;
Immunogens
A synthesized peptide derived from human MC2R, corresponding to a region within N-terminal amino acids.
- Q01718 ACTHR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Receptor for corticotropin (ACTH). This receptor is mediated by G proteins (G(s)) which activate adenylate cyclase (cAMP).
Cell membrane>Multi-pass membrane protein.
Melanocytes and corticoadrenal tissue.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signal transduction > cAMP signaling pathway. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
· Organismal Systems > Endocrine system > Aldosterone synthesis and secretion.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.