EMR4 Antibody - #DF4925
Product: | EMR4 Antibody |
Catalog: | DF4925 |
Description: | Rabbit polyclonal antibody to EMR4 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 55 KD; 51kD(Calculated). |
Uniprot: | Q86SQ3 |
RRID: | AB_2837278 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4925, RRID:AB_2837278.
Fold/Unfold
EGF like module containing mucin like hormone receptor like 4; EGF TM7 receptor EMR4; EMR4P; FIRE; G protein coupled receptor 127; G protein coupled receptor PGR16; GPR127; PGR16; Putative EGF like module containing mucin like hormone receptor like 4;
Immunogens
A synthesized peptide derived from human EMR4, corresponding to a region within the internal amino acids.
- Q86SQ3 AGRE4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGSRFLLVLLSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGGYICSCLVKYTLFNFLAGIIDYDHPDCYENNSQGTTQSNVDIWVSGVKPGFGKQLPGDKRTKHICVYWEGSEGGWSTEGCSHVHSNGSYTKCKCFHLSSFAVLVALAPKEDPVLTVITQVGLTISLLCLFLAILTFLLCRPIQNTSTSLHLELSLCLFLAHLLFLTGINRTEPEVLCSIIAGLLHFLYLACFTWMLLEGLHLFLTVRNLKVANYTSTGRFKKRFMYPVGYGIPAVIIAVSAIVGPQNYGTFTCWLKLDKGFIWSFMGPVAVIILINLVFYFQVLWILRSKLSSLNKEVSTIQDTRVMTFKAISQLFILGCSWGLGFFMVEEVGKTIGSIIAYSFTIINTLQGVLLFVVHCLLNRQVRLIILSVISLVPKSN
Research Backgrounds
May mediate the cellular interaction between myeloid cells and B-cells.
Glycosylated.
Proteolytically cleaved into 2 subunits, an extracellular alpha subunit and a seven-transmembrane subunit.
Cell membrane>Multi-pass membrane protein.
Secreted.
Belongs to the G-protein coupled receptor 2 family. Adhesion G-protein coupled receptor (ADGR) subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.