GPR31 Antibody - #DF4970
| Product: | GPR31 Antibody |
| Catalog: | DF4970 |
| Description: | Rabbit polyclonal antibody to GPR31 |
| Application: | ELISA(peptide) |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Dog |
| Mol.Wt.: | 33 KD(Observed); 35kD(Calculated). |
| Uniprot: | O00270 |
| RRID: | AB_2837323 |
Control Products
Related Downloads
Protocols
Product Info
Cite Format: Affinity Biosciences Cat# DF4970, RRID:AB_2837323.
Fold/Unfold
12-(S)-HETE acid receptor; 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid (HETE) receptor; 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor; 12-(S)-HYDROXYEICOSATETRAENOIC ACID RECEPTOR; 12-HETER; bA517H2.2 (G protein coupled receptor 31); G protein coupled receptor 31; GPR31; HETER; HETER1; OTTHUMP00000017616; Probable G protein coupled receptor 31;
Immunogens
A synthesized peptide derived from human GPR31, corresponding to a region within the internal amino acids.
- O00270 GPR31_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALADLLLAACLPFLAAFYLSLQAWHLGRVGCWALHFLLDLSRSVGMAFLAAVALDRYLRVVHPRLKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEALSCLQFVLPFGLIVFCNAGIIRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTLRGKGQAAEPPDFNPRDSYS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
High-affinity receptor for 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid (12-S-HETE). 12-(S)-HETE is an arachidonic acid metabolite secreted by platelets and tumor cells, and known to induce endothelial cells retraction allowing invasive cell access to the subendothelial matrix, which is a critical step for extravasation or metastasis. Ligand-binding lead to activation of ERK1/2 (MAPK3/MAPK1), MEK, and NF-kappa-B.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.