OR11L1 Antibody - #DF5010
(2)
| Product: | OR11L1 Antibody |
| Catalog: | DF5010 |
| Description: | Rabbit polyclonal antibody to OR11L1 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Rat |
| Mol.Wt.: | 34 KD; 37kD(Calculated). |
| Uniprot: | Q8NGX0 |
| RRID: | AB_2837369 |
Related Downloads
Protocols
Product Info
Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Reactivity:
Human,Rat
Clonality:
Polyclonal
Specificity:
OR11L1 Antibody detects endogenous levels of total OR11L1.
RRID:
AB_2837369
Cite Format: Affinity Biosciences Cat# DF5010, RRID:AB_2837369.
Cite Format: Affinity Biosciences Cat# DF5010, RRID:AB_2837369.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:
Fold/Unfold
O11L1_HUMAN; Olfactory receptor 11L1; Olfactory receptor family 11 subfamily L member 1; Olfactory receptor OR1-50; OR11L1;
Immunogens
Immunogen:
A synthesized peptide derived from human OR11L1, corresponding to a region within the internal amino acids.
Uniprot:
Gene(ID):
Sequence:
- Q8NGX0 O11L1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEPQNTSTVTNFQLLGFQNLLEWQALLFVIFLLIYCLTIIGNVVIITVVSQGLRLHSPMYMFLQHLSFLEVWYTSTTVPLLLANLLSWGQAISFSACMAQLYFFVFLGATECFLLAFMAYDRYLAICSPLRYPFLMHRGLCARLVVVSWCTGVSTGFLPSLMISRLDFCGRNQINHFFCDLPPLMQLSCSRVYITEVTIFILSIAVLCICFFLTLGPYVFIVSSILRIPSTSGRRKTFSTCGSHLAVVTLYYGTMISMYVCPSPHLLPEINKIISVFYTVVTPLLNPVIYSLRNKDFKEAVRKVMRRKCGILWSTSKRKFLY
Research Backgrounds
Function:
Odorant receptor.
Subcellular Location:
Cell membrane>Multi-pass membrane protein.
Family&Domains:
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Organismal Systems > Sensory system > Olfactory transduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.