OR4F4/4F5/4F17 Antibody - #DF5019
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF5019, RRID:AB_2837378.
Fold/Unfold
O4F17_HUMAN; Olfactory receptor 4F11; Olfactory receptor 4F17; Olfactory receptor 4F18; Olfactory receptor 4F19; OR4F11P; OR4F17; OR4F18; OR4F19; HS14a-1-A; OLA-7501; Olfactory receptor 4F4; Olfactory receptor family 4 subfamily F member 18; Olfactory receptor family 4 subfamily F member 4; Olfactory receptor OR19-3; OR4F17; OR4F18; OR4F4; OR4F4_HUMAN; HS14a-1-A; OLA-7501; Olfactory receptor 4F11; Olfactory receptor 4F17; Olfactory receptor 4F18; Olfactory receptor 4F19; Olfactory receptor 4F4; Olfactory receptor 4F5; Olfactory receptor family 4 subfamily F member 11 pseudogene; Olfactory receptor family 4 subfamily F member 17; Olfactory receptor family 4 subfamily F member 18; Olfactory receptor family 4 subfamily F member 19; Olfactory receptor family 4 subfamily F member 4; Olfactory receptor family 4 subfamily F member 5; Olfactory receptor OR19-3; OR4F11P; OR4F17; OR4F18; OR4F19; OR4F4; OR4F4_HUMAN; OR4F5;
Immunogens
A synthesized peptide derived from human OR4F4/4F5/4F17, corresponding to a region within C-terminal amino acids.
- Q8NGA8 O4F17_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVTEFIFLGLSDSQGLQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLSLIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAICKPLHYTTIMCGNACVGIMAVAWGIGFLHSVSQLAFAVHLPFCGPNEVDSFYCDLPRVIKLACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHRPLDKSSKALSTLTAHITVVLLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRQLRKWDAHSSVKF
- Q96R69 OR4F4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVTEFIFLGLSDSQELQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLSLIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAICKPLHYTTIMCGNACVGIMAVAWGIGFLHSVSQLAFAVHLPFCGPNEVDSFYCDLPRVIKLACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHCPLDKSSKALSTLTAHITVVLLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRRLRKWDAHSSVKF
- Q8NH21 OR4F5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVTEFIFLGLSDSQELQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLSLIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAICKPLHYTTIMCGNACVGIMAVTWGIGFLHSVSQLAFAVHLLFCGPNEVDSFYCDLPRVIKLACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHRPLDKSSKALSTLTAHITVVLLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRQLRKWDAHSSVKF
Research Backgrounds
Odorant receptor.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Odorant receptor.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Odorant receptor.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Organismal Systems > Sensory system > Olfactory transduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.