OLFML2A Antibody - #DF5039
Product: | OLFML2A Antibody |
Catalog: | DF5039 |
Description: | Rabbit polyclonal antibody to OLFML2A |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 73 KD; 73kD(Calculated). |
Uniprot: | Q68BL7 |
RRID: | AB_2837398 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF5039, RRID:AB_2837398.
Fold/Unfold
FLJ00237; Olfactomedin like 2A; Olfactomedin like protein 2A; OLM2A_HUMAN; Photomedin 1; PRO34319; UNQ9394/PRO34319;
Immunogens
A synthesized peptide derived from human OLFML2A, corresponding to a region within the internal amino acids.
In the kidney expressed only by podocytes, wherein they localize to major processes.
- Q68BL7 OLM2A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAALPPRPLLLLPLVLLLSGRPTRADSKVFGDLDQVRMTSEGSDCRCKCIMRPLSKDACSRVRSGRARVEDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQSMVDLLEGTLYSMDLMKVHAYVHKVASQMNTLEESIKANLSRENEVVKDSVRHLSEQLRHYENHSAIMLGIKKELSRLGLQLLQKDAAAAPATPATGTGSKAQDTARGKGKDISKYGSVQKSFADRGLPKPPKEKLLQVEKLRKESGKGSFLQPTAKPRALAQQQAVIRGFTYYKAGKQEVTEAVADNTLQGTSWLEQLPPKVEGRSNSAEPNSAEQDEAEPRSSERVDLASGTPTSIPATTTTATTTPTPTTSLLPTEPPSGPEVSSQGREASCEGTLRAVDPPVRHHSYGRHEGAWMKDPAARDDRIYVTNYYYGNSLVEFRNLENFKQGRWSNMYKLPYNWIGTGHVVYQGAFYYNRAFTKNIIKYDLRQRFVASWALLPDVVYEDTTPWKWRGHSDIDFAVDESGLWVIYPAVDDRDEAQPEVIVLSRLDPGDLSVHRETTWKTRLRRNSYGNCFLVCGILYAVDTYNQQEGQVAYAFDTHTGTDARPQLPFLNEHAYTTQIDYNPKERVLYAWDNGHQLTYTLHFVV
Research Backgrounds
May be cleaved at Lys-295 after secretion.
O-glycosylated but not N-glycosylated.
Secreted.
Note: Localizes to the podocyte major processes. Colocalized with the major process protein VIM throughout podocyte development.
In the kidney expressed only by podocytes, wherein they localize to major processes.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.