Melanopsin Antibody - #DF5041
| Product: | Melanopsin Antibody |
| Catalog: | DF5041 |
| Description: | Rabbit polyclonal antibody to Melanopsin |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Sheep, Rabbit, Dog |
| Mol.Wt.: | 55 KD; 53kD(Calculated). |
| Uniprot: | Q9UHM6 |
| RRID: | AB_2837400 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF5041, RRID:AB_2837400.
Fold/Unfold
Melanopsin; MGC142118; MOP; OPN 4; OPN4; OPN4_HUMAN; Opsin 4; Opsin-4; Opsin4;
Immunogens
Eye. Expression is restricted within the ganglion and amacrine cell layers of the retina.
- Q9UHM6 OPN4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNPPSGPRVPPSPTQEPSCMATPAPPSWWDSSQSSISSLGRLPSISPTAPGTWAAAWVPLPTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMSFTQAPVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIRETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAIAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGWTHMEAAAVWGAAQQANGRSLYGQGLEDLEAKAPPRPQGHEAETPGKTKGLIPSQDPRM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UHM6 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S379 | Phosphorylation | Uniprot | |
| S391 | Phosphorylation | Uniprot | |
| T392 | Phosphorylation | Uniprot | |
| T397 | Phosphorylation | Uniprot | |
| S398 | Phosphorylation | Uniprot |
Research Backgrounds
Photoreceptor required for regulation of circadian rhythm. Contributes to pupillar reflex and other non-image forming responses to light. May be able to isomerize covalently bound all-trans retinal back to 11-cis retinal (By similarity).
Cell membrane>Multi-pass membrane protein.
Note: Found in soma, dendrites and proximal part of axons of certain retinal ganglion cells.
Eye. Expression is restricted within the ganglion and amacrine cell layers of the retina.
Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.