GPRC5A Antibody - #DF5148

(1)   (5)  
Product: GPRC5A Antibody
Catalog: DF5148
Description: Rabbit polyclonal antibody to GPRC5A
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 40 KD; 40kD(Calculated).
Uniprot: Q8NFJ5
RRID: AB_2837507

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, WB 1:500-1:1000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(80%), Bovine(90%), Horse(90%), Sheep(80%), Rabbit(90%), Dog(100%)
Clonality:
Polyclonal
Specificity:
GPRC5A Antibody detects endogenous levels of total GPRC5A.
RRID:
AB_2837507
Cite Format: Affinity Biosciences Cat# DF5148, RRID:AB_2837507.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

G protein coupled receptor family C group 5 member A; G-protein coupled receptor family C group 5 member A; GPCR 5A; GPCR5A; Gprc 5a; Gprc5a; Orphan G protein coupling receptor PEIG 1; Orphan G protein coupling receptor PEIG1; Orphan G-protein-coupling receptor PEIG-1; RAI 3; RAI3_HUMAN; Raig 1; RAIG-1; Raig1; Retinoic acid induced 3; Retinoic acid induced gene 1 protein; Retinoic acid induced protein 3; Retinoic acid responsive; Retinoic acid responsive gene; Retinoic acid-induced gene 1 protein; Retinoic acid-induced protein 3;

Immunogens

Immunogen:

A synthesized peptide derived from human GPRC5A, corresponding to a region within the internal amino acids.

Uniprot:

Q8NFJ5(RAI3_HUMAN) >>Visit HPA database.

Gene(ID):
GPRC5A(9052)
Expression:
Q8NFJ5 RAI3_HUMAN:

Expressed at high level in fetal and adult lung tissues but repressed in most human lung cancers (PubMed:9857033, PubMed:18000218). Constitutively expressed in fetal kidney and adult placenta, kidney, prostate, testis, ovary, small intestine, colon, stomach, and spinal chord at low to moderate levels. Not detectable in fetal heart, brain, and liver and adult heart, brain, liver, skeletal muscle, pancreas, spleen, thymus, and peripheral leukocytes. According to PubMed:10783259, expressed at low but detectable level in pancreas and heart.

Sequence:
MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Dog
100
Horse
90
Bovine
90
Rabbit
90
Pig
80
Sheep
80
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Orphan receptor. Could be involved in modulating differentiation and maintaining homeostasis of epithelial cells. This retinoic acid-inducible GPCR provide evidence for a possible interaction between retinoid and G-protein signaling pathways. Functions as a negative modulator of EGFR signaling (By similarity). May act as a lung tumor suppressor.

PTMs:

Phosphorylated in two conserved double-tyrosine motifs, TYR-317/TYR-320 and TYR-347/TYR-350, by EGFR; leading to inactivation of the tumor suppressive function of GPRC5A in lung cancer cells. TYR-317 and TYR-320 are the preferred residues responsible for EGFR-mediated GPRC5A phosphorylation.

Subcellular Location:

Cell membrane>Multi-pass membrane protein. Cytoplasmic vesicle membrane>Multi-pass membrane protein.
Note: Localized in perinuclear vesicles, probably Golgi-associated vesicles.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed at high level in fetal and adult lung tissues but repressed in most human lung cancers. Constitutively expressed in fetal kidney and adult placenta, kidney, prostate, testis, ovary, small intestine, colon, stomach, and spinal chord at low to moderate levels. Not detectable in fetal heart, brain, and liver and adult heart, brain, liver, skeletal muscle, pancreas, spleen, thymus, and peripheral leukocytes. According to expressed at low but detectable level in pancreas and heart.

Family&Domains:

Belongs to the G-protein coupled receptor 3 family.

References

1). Gut microbiome and serum short-chain fatty acids are associated with responses to chemo- or targeted therapies in Chinese patients with lung cancer. Frontiers in microbiology, 2023 (PubMed: 37564290) [IF=5.2]

Application: IHC    Species: human    Sample: LC cells

Figure 5. Isobutyric acid regulated G protein-coupled receptor (GPCR) expression and histone acetyltransferase (HAT) activity. For the expression of GPCRs, the results of RT-qPCR (A), Western blot (B), and immunocytochemical staining (C) showed that GPR41, GPR43, and GPRC5A expressions were significantly higher, while PAR1 expression was significantly lower in isobutyric acid treatment group (1.85 mM) than the control groups (control and NC). Immunofluorescence staining (D) identified the expression location of GPCRs. For the expression of acetyl-histones and histones, the results of Western blot (E) and immunocytochemical staining (F) showed that acetyl-histone H3 and H4 expressions were significantly higher in the isobutyric acid treatment group (1.85 mM) than the control groups (control and NC), whereas Western blot results showed that there was no significant difference of the expression of histone H3 and H4 between isobutyric acid treatment group and the control groups. Immunofluorescence staining (G) identified the expression location of acetyl-histone H3 and H4. HAT activity assay (H) results showed that HAT activity was increased in the isobutyric acid treatment group (1.85mM) than in the control groups (control and NC). P-values were calculated using Student's t-tests. ns: no significance; *p < 0.05; **p < 0.01; ***p < 0.001. All experiments were repeated three times. NC, negative control (0mM).

Application: IF/ICC    Species: human    Sample: LC cells

Figure 5. Isobutyric acid regulated G protein-coupled receptor (GPCR) expression and histone acetyltransferase (HAT) activity. For the expression of GPCRs, the results of RT-qPCR (A), Western blot (B), and immunocytochemical staining (C) showed that GPR41, GPR43, and GPRC5A expressions were significantly higher, while PAR1 expression was significantly lower in isobutyric acid treatment group (1.85 mM) than the control groups (control and NC). Immunofluorescence staining (D) identified the expression location of GPCRs. For the expression of acetyl-histones and histones, the results of Western blot (E) and immunocytochemical staining (F) showed that acetyl-histone H3 and H4 expressions were significantly higher in the isobutyric acid treatment group (1.85 mM) than the control groups (control and NC), whereas Western blot results showed that there was no significant difference of the expression of histone H3 and H4 between isobutyric acid treatment group and the control groups. Immunofluorescence staining (G) identified the expression location of acetyl-histone H3 and H4. HAT activity assay (H) results showed that HAT activity was increased in the isobutyric acid treatment group (1.85mM) than in the control groups (control and NC). P-values were calculated using Student's t-tests. ns: no significance; *p < 0.05; **p < 0.01; ***p < 0.001. All experiments were repeated three times. NC, negative control (0mM).

Application: WB    Species: human    Sample: LC cells

Figure 5. Isobutyric acid regulated G protein-coupled receptor (GPCR) expression and histone acetyltransferase (HAT) activity. For the expression of GPCRs, the results of RT-qPCR (A), Western blot (B), and immunocytochemical staining (C) showed that GPR41, GPR43, and GPRC5A expressions were significantly higher, while PAR1 expression was significantly lower in isobutyric acid treatment group (1.85 mM) than the control groups (control and NC). Immunofluorescence staining (D) identified the expression location of GPCRs. For the expression of acetyl-histones and histones, the results of Western blot (E) and immunocytochemical staining (F) showed that acetyl-histone H3 and H4 expressions were significantly higher in the isobutyric acid treatment group (1.85 mM) than the control groups (control and NC), whereas Western blot results showed that there was no significant difference of the expression of histone H3 and H4 between isobutyric acid treatment group and the control groups. Immunofluorescence staining (G) identified the expression location of acetyl-histone H3 and H4. HAT activity assay (H) results showed that HAT activity was increased in the isobutyric acid treatment group (1.85mM) than in the control groups (control and NC). P-values were calculated using Student's t-tests. ns: no significance; *p < 0.05; **p < 0.01; ***p < 0.001. All experiments were repeated three times. NC, negative control (0mM).

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.