GPRC5A Antibody - #DF5148

Product: | GPRC5A Antibody |
Catalog: | DF5148 |
Description: | Rabbit polyclonal antibody to GPRC5A |
Application: | WB IHC IF/ICC |
Cited expt.: | WB, IHC, IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 40 KD; 40kD(Calculated). |
Uniprot: | Q8NFJ5 |
RRID: | AB_2837507 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF5148, RRID:AB_2837507.
Fold/Unfold
G protein coupled receptor family C group 5 member A; G-protein coupled receptor family C group 5 member A; GPCR 5A; GPCR5A; Gprc 5a; Gprc5a; Orphan G protein coupling receptor PEIG 1; Orphan G protein coupling receptor PEIG1; Orphan G-protein-coupling receptor PEIG-1; RAI 3; RAI3_HUMAN; Raig 1; RAIG-1; Raig1; Retinoic acid induced 3; Retinoic acid induced gene 1 protein; Retinoic acid induced protein 3; Retinoic acid responsive; Retinoic acid responsive gene; Retinoic acid-induced gene 1 protein; Retinoic acid-induced protein 3;
Immunogens
A synthesized peptide derived from human GPRC5A, corresponding to a region within the internal amino acids.
Expressed at high level in fetal and adult lung tissues but repressed in most human lung cancers (PubMed:9857033, PubMed:18000218). Constitutively expressed in fetal kidney and adult placenta, kidney, prostate, testis, ovary, small intestine, colon, stomach, and spinal chord at low to moderate levels. Not detectable in fetal heart, brain, and liver and adult heart, brain, liver, skeletal muscle, pancreas, spleen, thymus, and peripheral leukocytes. According to PubMed:10783259, expressed at low but detectable level in pancreas and heart.
- Q8NFJ5 RAI3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Orphan receptor. Could be involved in modulating differentiation and maintaining homeostasis of epithelial cells. This retinoic acid-inducible GPCR provide evidence for a possible interaction between retinoid and G-protein signaling pathways. Functions as a negative modulator of EGFR signaling (By similarity). May act as a lung tumor suppressor.
Phosphorylated in two conserved double-tyrosine motifs, TYR-317/TYR-320 and TYR-347/TYR-350, by EGFR; leading to inactivation of the tumor suppressive function of GPRC5A in lung cancer cells. TYR-317 and TYR-320 are the preferred residues responsible for EGFR-mediated GPRC5A phosphorylation.
Cell membrane>Multi-pass membrane protein. Cytoplasmic vesicle membrane>Multi-pass membrane protein.
Note: Localized in perinuclear vesicles, probably Golgi-associated vesicles.
Expressed at high level in fetal and adult lung tissues but repressed in most human lung cancers. Constitutively expressed in fetal kidney and adult placenta, kidney, prostate, testis, ovary, small intestine, colon, stomach, and spinal chord at low to moderate levels. Not detectable in fetal heart, brain, and liver and adult heart, brain, liver, skeletal muscle, pancreas, spleen, thymus, and peripheral leukocytes. According to expressed at low but detectable level in pancreas and heart.
Belongs to the G-protein coupled receptor 3 family.
References
Application: IHC Species: human Sample: LC cells
Application: IF/ICC Species: human Sample: LC cells
Application: WB Species: human Sample: LC cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.