VN1R2 Antibody - #DF5174
Product: | VN1R2 Antibody |
Catalog: | DF5174 |
Description: | Rabbit polyclonal antibody to VN1R2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 46 KD; 44kD(Calculated). |
Uniprot: | Q8NFZ6 |
RRID: | AB_2837523 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF5174, RRID:AB_2837523.
Fold/Unfold
G-protein coupled receptor GPCR25; hGPCR25; pheromone receptor; V1r like receptor 2; V1R-like 2; V1r-like receptor 2; V1RL2; VN1R2; VN1R2_HUMAN; vomeronasal 1 receptor 2; Vomeronasal type 1 receptor 2; Vomeronasal type-1 receptor 2;
Immunogens
A synthesized peptide derived from human VN1R2, corresponding to a region within the internal amino acids.
- Q8NFZ6 VN1R2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTHTLYPTPFALYPINISAAWHLGPLPVSCFVSNKYQCSLAFGATTGLRVLVVVVPQTQLSFLSSLCLVSLFLHSLVSAHGEKPTKPVGLDPTLFQVVVGILGNFSLLYYYMFLYFRGYKPRSTDLILRHLTVADSLVILSKRIPETMATFGLKHFDNYFGCKFLLYAHRVGRGVSIGSTCLLSVFQVITINPRNSRWAEMKVKAPTYIGLSNILCWAFHMLVNAIFPIYTTGKWSNNNITKKGDLGYCSAPLSDEVTKSVYAALTSFHDVLCLGLMLWASSSIVLVLYRHKQQVQHICRNNLYPNSSPGNRAIQSILALVSTFALCYALSFITYVYLALFDNSSWWLVNTAALIIACFPTISPFVLMCRDPSRSRLCSICCRRNRRFFHDFRKM
Research Backgrounds
Putative pheromone receptor.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.