MAGEA5 Antibody - #DF5196
Product: | MAGEA5 Antibody |
Catalog: | DF5196 |
Description: | Rabbit polyclonal antibody to MAGEA5 |
Application: | WB |
Reactivity: | Human, Mouse |
Mol.Wt.: | 36 KD; 13kD(Calculated). |
Uniprot: | P43359 |
RRID: | AB_2837545 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF5196, RRID:AB_2837545.
Fold/Unfold
Cancer/testis antigen 1.5; Cancer/testis antigen family 1 member 5; CT1.5; MAGA5_HUMAN; MAGE 5 antigen; MAGE 5a antigen; MAGE 5b antigen; MAGE-5 antigen; MAGE5; MAGEA4; MAGEA5; Melanoma antigen family A 5; Melanoma associated antigen 5; Melanoma-associated antigen 5; MGC129526;
Immunogens
Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes.
- P43359 MAGA5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTLGEVPAAGSPGPLKSPQGASAIPTAIDFTLWRQSIKGSSNQEEEGPSTSPDPESVFRAALSKKVADLIHFLLLKY
PTMs - P43359 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S83 | Phosphorylation | Uniprot |
Research Backgrounds
Not known, though may play a role tumor transformation or progression. In vitro promotes cell viability in melanoma cell lines.
Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.