OR10H3/10H4 Antibody - #DF5197
| Product: | OR10H3/10H4 Antibody |
| Catalog: | DF5197 |
| Description: | Rabbit polyclonal antibody to OR10H3/10H4 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 38 KD; 36kD(Calculated). |
| Uniprot: | O60404 | Q8NGA5 |
| RRID: | AB_2837546 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF5197, RRID:AB_2837546.
Fold/Unfold
OR10H4; MGC119147; MGC119149; Olfactory receptor 10H3; Olfactory receptor 10H4; Olfactory receptor family 10 subfamily H member 3; Olfactory receptor family 10 subfamily H member 4; Olfactory receptor OR19-24; Olfactory receptor OR19-28; OR10H3; OR19-28; O10H4_HUMAN; Olfactory receptor 10H4; Olfactory receptor family 10 subfamily H member 4; Olfactory receptor OR19 28; Olfactory receptor OR19-28; Olfactory receptor OR1928; OR10H4; OR19 28; OR1928;
Immunogens
- O60404 O10H3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPGQNYRTISEFILSGFSAFPQQLLPVLFLLYLLMFLFTLLGNLLIMATVWIERRLHTPMYLFLCALSISEILFTVAITPRMLADLLFTHRSITFVACAIQMFFSFMFGFTHSFLLMVMGYDHYVTICHPLHYNMLMSPRGCAHLVAWTWAGGSVMGMMVTMMVFHLTFCGSNVIHHFLCHVLSLLKLACGSKTSSVIMGVMLVCVTALIGCLFLIILSFVFIVAAILRIPSAEGRHKTFSTCVSHLTVVVMHYSFASLIYLKPKGLHSMYSDALMATTYTVFTPFLSPIIFSLRNKELKNAINKNFCRRFCPLSS
- Q8NGA5 O10H4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPSQNYSIISEFNLFGFSAFPQHLLPILFLLYLLMFLFTLLGNLLIMATIWIEHRLHTPMYLFLCTLSVSEILFTVAITPRMLADLLSTHHSITFVACANQMFFSFMFGFTHSFLLLVMGYDRYVAICHPLRYNVLMSPRDCAHLVACTWAGGSVMGMMVTTIVFHLTFCGSNVIHHFFCHVLSLLKLACENKTSSVIMGVMLVCVTALIGCLFLIILSYVFIVAAILRIPSAEGRHKTFSTCVSHLTVVVTHYSFASFIYLKPKGLHSMYSDALMATTYTVFTPFLSPIIFSLRNKELKNAINKNFYRKFCPPSS
PTMs - O60404/Q8NGA5 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S269 | Phosphorylation | Uniprot |
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S269 | Phosphorylation | Uniprot |
Research Backgrounds
Odorant receptor.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Odorant receptor.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Organismal Systems > Sensory system > Olfactory transduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.