Product: LYVE1 Antibody
Catalog: AF4202
Description: Rabbit polyclonal antibody to LYVE1
Application: WB IHC
Cited expt.:
Reactivity: Human, Mouse, Rat, Monkey
Mol.Wt.: 40 kd; 35kD(Calculated).
Uniprot: Q9Y5Y7
RRID: AB_2837586

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Monkey
Clonality:
Polyclonal
Specificity:
LYVE1 Antibody detects endogenous levels of total LYVE1.
RRID:
AB_2837586
Cite Format: Affinity Biosciences Cat# AF4202, RRID:AB_2837586.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Supplied at 1.0mg/mL in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl and glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Cell surface retention sequence-binding protein 1; CRSBP 1; CRSBP-1; CRSBP1; extracellular link domain containing 1; extracellular link domain-containing 1; Extracellular link domain-containing protein 1; HAR; Hyaluronic acid receptor; Lymphatic endothelium specific hyaluronan receptor; lymphatic vessel endothelial hyaluronan receptor 1; Lymphatic vessel endothelial hyaluronic acid receptor 1; LYVE 1; LYVE-1; LYVE1; LYVE1_HUMAN; XLKD1;

Immunogens

Immunogen:

A synthesized peptide derived from human LYVE1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q9Y5Y7 LYVE1_HUMAN:

Mainly expressed in endothelial cells lining lymphatic vessels.

Description:
Ligand-specific transporter trafficking between intracellular organelles (TGN) and the plasma membrane. Plays a role in autocrine regulation of cell growth mediated by growth regulators containing cell surface retention sequence binding (CRS). May act as an hyaluronan (HA) transporter, either mediating its uptake for catabolism within lymphatic endothelial cells themselves, or its transport into the lumen of afferent lymphatic vessels for subsequent re-uptake and degradation in lymph nodes.
Sequence:
MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV

Research Backgrounds

Function:

Ligand-specific transporter trafficking between intracellular organelles (TGN) and the plasma membrane. Plays a role in autocrine regulation of cell growth mediated by growth regulators containing cell surface retention sequence binding (CRS). May act as a hyaluronan (HA) transporter, either mediating its uptake for catabolism within lymphatic endothelial cells themselves, or its transport into the lumen of afferent lymphatic vessels for subsequent re-uptake and degradation in lymph nodes.

PTMs:

O-glycosylated.

Subcellular Location:

Membrane>Single-pass type I membrane protein.
Note: Localized to the plasma membrane and in vesicles near extranuclear membranes which may represent trans-Golgi network (TGN) and endosomes/prelysosomeal compartments. Undergoes ligand-dependent internalization and recycling at the cell surface.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Mainly expressed in endothelial cells lining lymphatic vessels.

References

1). Borneol-driven meningeal lymphatic drainage clears amyloid-β peptide to attenuate Alzheimer-like phenotype in mice. Theranostics, 2023 (PubMed: 36593948) [IF=12.4]

Application: IF/ICC    Species: mice    Sample:

Figure 2. BO-Ms clear tracers from the CNS into dCLNs via meningeal lymphatics. (A) Schematic of the experimental layout where mice were injected intracerebroventricular (i.c.v.) with OVA-FITC and then intragastrical administration (i.g.) of normal saline as a control group or BO-Ms as BO-Ms group. The meninges were harvested at 60 min after administration. (B) Representative the confluence of sinuses (COS), and the transverse sinus (TS) of meninges stained with anti-LYVE-1 antibody (red) showing OVA-FITC (green) distribution in the meningeal lymphatic vessels of the control group and BO-Ms group at 60 min. (Scale bars in the COS, 200 μm, detail, 50 μm. Scale bars in the TS, 100 μm, detail, 20 μm). (C) Schematic of the experimental layout where mice were injected intracerebroventricular (i.c.v.) with OVA-FITC and then intragastrical administration (i.g.) of normal saline as a control group or BO-Ms as BO-Ms group. The dCLNs were harvested at various times after administration. (D) The Ex vivo fluorescence imaging of OVA-FITC in mice dCLNs in both groups at 10, 30, 60, and 120 min. (E) Schematic of the experimental ligation of the afferent lymphatic vessel of the dCLNs. (F, G) After afferent lymphatic vessel ligation, representative dCLNs and hippocampus in the BO-Ms sham group and BO-Ms ligation group showed OVA-FITC in green and cell nuclei in blue. (Scale bars in the dCLNs sections, 200 μm. Scale bars in the brain sections, 100 μm).

2). Single-cell RNA sequencing reveals the cellular and molecular characteristics of high-grade and metastatic bladder cancer. Cellular oncology (Dordrecht, Netherlands), 2023 (PubMed: 37170046) [IF=4.9]

3). TRAF6 regulates the signaling pathway influencing colorectal cancer function through ubiquitination mechanisms. Cancer Science, 2022 (PubMed: 35179811) [IF=4.5]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.