Product: CD34 Antibody
Catalog: AF5149
Description: Rabbit polyclonal antibody to CD34
Application: WB IF/ICC
Cited expt.: IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Rabbit, Dog
Mol.Wt.: 120 kDa; 41kD(Calculated).
Uniprot: P28906
RRID: AB_2837635

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:0-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Rabbit(82%), Dog(82%)
Clonality:
Polyclonal
Specificity:
CD34 Antibody detects endogenous levels of total CD34.
RRID:
AB_2837635
Cite Format: Affinity Biosciences Cat# AF5149, RRID:AB_2837635.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CD34; CD34 antigen; CD34 molecule; CD34_HUMAN; Cluster designation 34; Hematopoietic progenitor cell antigen CD34; HPCA1; Mucosialin; OTTHUMP00000034733; OTTHUMP00000034734;

Immunogens

Immunogen:

A synthesized peptide derived from human CD34, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P28906 CD34_HUMAN:

Selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues.

Description:
Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins.
Sequence:
MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
82
Dog
82
Horse
70
Pig
60
Sheep
55
Bovine
45
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins.

PTMs:

Highly glycosylated.

Phosphorylated on serine residues by PKC.

Subcellular Location:

Membrane>Single-pass type I membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues.

Family&Domains:

Belongs to the CD34 family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs).   (View pathway)

· Organismal Systems > Immune system > Hematopoietic cell lineage.   (View pathway)

References

1). Baohuoside I chemosensitises breast cancer to paclitaxel by suppressing extracellular vesicle/CXCL1 signal released from apoptotic cells. Journal of extracellular vesicles, 2024 (PubMed: 39051750) [IF=16.0]

Application: IF/ICC    Species: Mouse    Sample:

FIGURE 10 BHS chemosensitises breast cancer in immunocompetent Balb/c mice by suppressing EV-Apo/TAM/PD-L1 signalling. (a) Representative images of tumours as well as the statistical analysis of tumour weights, tumour volumes and body weights of Balb/c mice among different groups. Paclitaxel (10 mg/kg/3d) and BHS (20 mg/kg/d) were administrated intraperitoneally, whereas EVs (200 µg/kg/3d) were administrated by a peritumoral injection. n = 9. (b) Representative images of the in vivo imaging assay, the harvested lungs and the lung HE staining assay. n = 3. (c, d) Infiltration levels of CD45+/F4/80+/CD206+ TAMs and CD45+/F4/80+/PD-L1+ TAMs in the TME of mice among different groups. n = 3. (e) Perforin/granzyme B production activity of cytotoxic CD8+ T cells in the TME of mice among different groups. n = 3. (f) Immunofluorescence analysis of TSG101 (EV-specific marker) and CXCL1 expression levels in breast tumour tissues of different groups. (g) Immunofluorescence analysis of CD34 (vascular marker) in breast tumour tissues and lung metastatic foci of different groups. *p < 0.05, **p < 0.01.

2). Stimulation by exosomes from hypoxia-preconditioned hair follicle mesenchymal stem cells facilitates mitophagy by inhibiting the PI3K/AKT/mTOR signaling pathway to alleviate ulcerative colitis. Theranostics, 2024 (PubMed: 39113800) [IF=12.4]

3). Berberine-mediated up-regulation of surfactant protein D facilitates cartilage repair by modulating immune responses via the inhibition of TLR4/NF-ĸB signaling. Pharmacological Research, 2020 (PubMed: 32057894) [IF=9.1]

Application: IHC    Species: rat    Sample: knee joints

Fig. 5. Chondrocyte apoptosis and immune molecular biomarkers were inhibited by BBR binding to SP-D in vivo in OA. OA model rats (n = 5/group) were injected using 25 μl of 200 μM BBR, followed by 25 μl rhSP-D (40 μg/mL) 1 day later. Sham-operated and OA-induction groups received an injection of 50 μl PBS into the right knee joint. For rats receiving rAAV-GFP or rAAV-SP-D shRNA, injections were performed for 10 consecutive days beginning 1 day after the initial BBR injection. At 10 weeks post-surgery, animals were sacrificed and the knee joints were collected for TUNEL and IHC analysis. (A) TUNEL staining (400 ×) was used to assess apoptosis. The p-p65, TLR4, F4/80, CD68, and CD34 expression was assessed via IHC (400 × with higher 800 × magnification inset). (B) Quantification of the indicated proteins in IHC images. Each column represents the mean ± SEM (n = 5). ***P < 0.001 versus the sham-operated group; ##P < 0.01 and ###P < 0.001 versus the OA-induction group; &P < 0.05 and &&P < 0.01 versus the OA + BBR group.

4). Mangiferin alleviates diabetic pulmonary fibrosis in mice via inhibiting endothelial-mesenchymal transition through AMPK/FoxO3/SIRT3 axis. Acta pharmacologica Sinica, 2024 (PubMed: 38225395) [IF=6.9]

5). Resolvin D1 ameliorates Inflammation-Mediated Blood-Brain Barrier Disruption After Subarachnoid Hemorrhage in rats by Modulating A20 and NLRP3 Inflammasome. Frontiers in Pharmacology, 2021 (PubMed: 33732145) [IF=5.6]

6). Radiation-induced FAP + fibroblasts are involved in keloid recurrence after radiotherapy. Frontiers in Cell and Developmental Biology, 2022 (PubMed: 36092734) [IF=4.6]

7). Empagliflozin promotes skin flap survival by activating AMPK signaling pathway. European journal of pharmacology, 2024 (PubMed: 39694175) [IF=4.2]

8). Myrtenol promotes skin flap survival by inhibiting apoptosis and promoting autophagy via the MEK/ERK pathway.. Archives of biochemistry and biophysics, 2025 (PubMed: 39603374) [IF=3.9]

9). Protective effect of bone morphogenetic protein-7 induced differentiation of bone marrow mesenchymal stem cells in rat with acute spinal cord injury. Functional & integrative genomics, 2023 (PubMed: 36849554) [IF=3.9]

10). BCL2L10 inhibits growth and metastasis of hepatocellular carcinoma both in vitro and in vivo. MOLECULAR CARCINOGENESIS, 2017 (PubMed: 27770580) [IF=3.0]

Application: IHC    Species: mouse    Sample:

(D) Representative microscopic feature of subtaneous tumor in H&E-stained sections of nude mice (left). CD34 protein expression was higher in tumors with low expression of BCL2L10 by IHC (middle and right).

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.