Product: Cathepsin B Antibody
Catalog: AF5189
Description: Rabbit polyclonal antibody to Cathepsin B
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 37 kDa; 38kD(Calculated).
Uniprot: P07858
RRID: AB_2837675

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Cathepsin B Antibody detects endogenous levels of total Cathepsin B.
RRID:
AB_2837675
Cite Format: Affinity Biosciences Cat# AF5189, RRID:AB_2837675.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Amyloid precursor protein secretase; APP secretase; APPS; CATB_HUMAN; Cathepsin B heavy chain; Cathepsin B1; CathepsinB; CPSB; CTSB; cysteine protease; OTTHUMP00000116009; OTTHUMP00000229510; OTTHUMP00000229511; OTTHUMP00000229512; OTTHUMP00000229514; OTTHUMP00000229515; OTTHUMP00000229516; Preprocathepsin B;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P07858 CATB_HUMAN:

Expressed in the stratum spinosum of the epidermis. Weak expression is detected in the stratum granulosum.

Description:
Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.
Sequence:
MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI

PTMs - P07858 As Substrate

Site PTM Type Enzyme
Y33 Phosphorylation
S169 Phosphorylation
Y173 Phosphorylation
N192 N-Glycosylation
C211 S-Nitrosylation
Y215 Phosphorylation
Y219 Phosphorylation
K223 Ubiquitination
K237 Ubiquitination
Y244 Phosphorylation
C319 S-Nitrosylation

Research Backgrounds

Function:

Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Cleaves matrix extracellular phosphoglycoprotein MEPE. Involved in the solubilization of cross-linked TG/thyroglobulin in the thyroid follicle lumen (By similarity). Has also been implicated in tumor invasion and metastasis.

Subcellular Location:

Lysosome. Melanosome. Secreted>Extracellular space. Apical cell membrane>Peripheral membrane protein>Extracellular side.
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV (PubMed:17081065). Localizes to the lumen of thyroid follicles and to the apical membrane of thyroid epithelial cells (By similarity).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in the stratum spinosum of the epidermis. Weak expression is detected in the stratum granulosum.

Subunit Structure:

Dimer of a heavy chain and a light chain cross-linked by a disulfide bond. Interacts with SRPX2. Directly interacts with SHKBP1.

Family&Domains:

Belongs to the peptidase C1 family.

Research Fields

· Cellular Processes > Transport and catabolism > Autophagy - animal.   (View pathway)

· Cellular Processes > Transport and catabolism > Lysosome.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Organismal Systems > Immune system > Antigen processing and presentation.   (View pathway)

· Organismal Systems > Immune system > NOD-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Renin secretion.

References

1). Pelargonic acid vanillylamide alleviates hepatic autophagy and ER stress in hepatic steatosis model. Food and Chemical Toxicology, 2023 (PubMed: 37611858) [IF=3.9]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.