Product: TOMM20 Antibody
Catalog: AF5206
Description: Rabbit polyclonal antibody to TOMM20
Application: WB IHC IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Rabbit, Dog, Xenopus
Mol.Wt.: 16 kDa; 16kD(Calculated).
Uniprot: Q15388
RRID: AB_2837692

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Rabbit(100%), Dog(100%), Xenopus(82%)
Clonality:
Polyclonal
Specificity:
TOMM20 Antibody detects endogenous levels of total TOMM20.
RRID:
AB_2837692
Cite Format: Affinity Biosciences Cat# AF5206, RRID:AB_2837692.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

KIAA0016; MAS20; MGC117367; Mitochondrial 20 kDa outer membrane protein; Mitochondrial import receptor subunit TOM20 homolog; MOM19; Outer mitochondrial membrane receptor Tom20; TOM20; TOM20_HUMAN; TOMM20; Translocase of outer mitochondrial membrane 20 homolog (yeast); Translocase of outer mitochondrial membrane 20 homolog type II;

Immunogens

Immunogen:

A synthesized peptide derived from human TOMM20, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Description:
Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore
Sequence:
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Dog
100
Rabbit
100
Xenopus
82
Sheep
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore (By similarity). Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases.

PTMs:

Ubiquitinated by PRKN during mitophagy, leading to its degradation and enhancement of mitophagy. Deubiquitinated by USP30.

Subcellular Location:

Mitochondrion outer membrane>Single-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the Tom20 family.

References

1). The role of the apoptosis-related protein BCL-B in the regulation of mitophagy in hepatic stellate cells during the regression of liver fibrosis. EXPERIMENTAL AND MOLECULAR MEDICINE, 2019 (PubMed: 30635551) [IF=9.5]

Application: WB    Species: mouse    Sample: hepatic fibrosis

Fig. 4 |Inhibition of mitophagy aggravates hepatic fibrosis in mice. a H&E staining of liver sections from mice; n = 6 per group; scale bar, 50 μm.b Sirius red staining of collagen in mouse liver sections; n = 6 per group; scale bar, 50 μm. c Representative western blots of TOM20, collagen I and α-SMA. Bar graph represents the mean ± SEM of three different experiments. *P < 0.05; **P < 0.01; and ***P < 0.001 vs. the indicated groups. d Serum levels of ALT and AST in the indicated mice. Bar graph represents the mean ± SEM; n = 6 per group. *P < 0.05 vs. The indicated groups

2). PBLD promotes IRF3 mediated the type I interferon (IFN-I) response and apoptosis to inhibit viral replication. Cell death & disease, 2024 (PubMed: 39362857) [IF=8.1]

3). Nicotinamide mononucleotide combined with PJ-34 protects microglial cells from lipopolysaccharide-induced mitochondrial impairment through NMNAT3-PARP1 axis. Journal of translational medicine, 2025 (PubMed: 40050860) [IF=7.4]

4). Gallic acid alleviates exercise-induced muscle damage by inhibiting mitochondrial oxidative stress and ferroptosis. Journal of translational medicine, 2025 (PubMed: 39780143) [IF=7.4]

5). Mitochondrial transplantation following cardiopulmonary resuscitation improves neurological function in rats by inducing M2-type MG/MΦ polarization. Journal of translational medicine, 2024 (PubMed: 39529087) [IF=7.4]

Application: IF/ICC    Species: Rat    Sample: hippocampal tissue

Fig. 4 Transferred mitochondria in MG/MΦ increased the number of mitochondria in hippocampus, and improved the morphology and structure of mitochondria in MG/MΦ. (A) Immunofluorescence analysis of mitochondria in hippocampal tissue. Green-stained cells are MG/MΦ, blue-stained regions are nuclei, and red arrows indicate the Mito-tracker Red CMXRos labeled exogenous mitochondria (400×, n = 3). (B) Immunofluorescence analysis of mitochondrial number. Blue-stained regions are nuclei, and red-stained regions are mitochondria in the hippocampus (400×, n = 3). (C) The mean gray value of TOMM20. (n = 3). (D) Morphology and structure of mitochondria in MG/MΦ were observed by electron microscopy. The red arrows indicate mitochondria; (scale bar 500 nm, n = 3); nsp > 0.05; *** p 

6). PINK1/Parkin pathway-mediated mitophagy by AS-IV to explore the molecular mechanism of muscle cell damage. Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie, 2023 (PubMed: 36948131) [IF=6.9]

Application: WB    Species: Rat    Sample: L6 myoblasts

Fig. 3. AS-IV ameliorates mitochondrial damage induced by H2O2 combined with CCCP in L6 myoblasts. (A, B) Effects of AS-IV on intracellular ROS (bar = 100 µm). (C) Effects of AS-IV on ATP activities. (D) Effects of AS-IV on Tom 20 mRNA expression. (E) Effects of AS-IV on Tim 23 mRNA expression. (F) Effects of AS-IV on VDAC1 mRNA expression. (G) Effects of AS-IV on Tom 20 protein expression. (H) Effects of AS-IV on Tim 23 protein expression. (I) Effects of AS-IV on VDAC1 protein expression. ★P 

7). Regulatory mechanism of perinatal nonylphenol exposure on cardiac mitochondrial autophagy and the PINK1/Parkin signaling pathway in male offspring rats. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2024 (PubMed: 38367424) [IF=6.7]

8). Dihydromyricetin regulates the miR-155-5p/SIRT1/VDAC1 pathway to promote liver regeneration and improve alcohol-induced liver injury. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2025 (PubMed: 39986231) [IF=6.7]

9). Transplantation of exogenous mitochondria mitigates myocardial dysfunction after cardiac arrest. eLife, 2025 (PubMed: 40207621) [IF=6.4]

10). PRG4 mitigates hemorrhagic shock-induced cardiac injury by inhibiting mitochondrial dysregulation, oxidative stress and NLRP3-mediated pyroptosis. International immunopharmacology, 2024 (PubMed: 38897120) [IF=4.8]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.