TOMM20 Antibody - #AF5206

Product: | TOMM20 Antibody |
Catalog: | AF5206 |
Description: | Rabbit polyclonal antibody to TOMM20 |
Application: | WB IHC IF/ICC |
Cited expt.: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Rabbit, Dog, Xenopus |
Mol.Wt.: | 16 kDa; 16kD(Calculated). |
Uniprot: | Q15388 |
RRID: | AB_2837692 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF5206, RRID:AB_2837692.
Fold/Unfold
KIAA0016; MAS20; MGC117367; Mitochondrial 20 kDa outer membrane protein; Mitochondrial import receptor subunit TOM20 homolog; MOM19; Outer mitochondrial membrane receptor Tom20; TOM20; TOM20_HUMAN; TOMM20; Translocase of outer mitochondrial membrane 20 homolog (yeast); Translocase of outer mitochondrial membrane 20 homolog type II;
Immunogens
A synthesized peptide derived from human TOMM20, corresponding to a region within the internal amino acids.
- Q15388 TOM20_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore (By similarity). Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases.
Ubiquitinated by PRKN during mitophagy, leading to its degradation and enhancement of mitophagy. Deubiquitinated by USP30.
Mitochondrion outer membrane>Single-pass membrane protein.
Belongs to the Tom20 family.
References
Application: WB Species: mouse Sample: hepatic fibrosis
Application: WB Species: Rat Sample: L6 myoblasts
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.