Product: LEG7 Antibody
Catalog: AF5300
Description: Rabbit polyclonal antibody to LEG7
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 15 KD; 15kD(Calculated).
Uniprot: P47929
RRID: AB_2837785

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
LEG7 Antibody detects endogenous levels of total LEG7.
RRID:
AB_2837785
Cite Format: Affinity Biosciences Cat# AF5300, RRID:AB_2837785.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Gal-7; GAL7; Galectin 7B; Galectin-7; HKL-14; Human keratinocyte lectin 14; Keratinocyte lectin 14; Lectin galactoside binding soluble 7; Lectin, galactoside binding, soluble, 7B; LEG7_HUMAN; LGALS7; LGALS7A; LGALS7B; P53 induced protein 1; p53-induced gene 1 protein; Pi7; PIG1; TP53I1;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P47929 LEG7_HUMAN:

Mainly expressed in stratified squamous epithelium.

Description:
Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.
Sequence:
MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

PTMs - P47929 As Substrate

Site PTM Type Enzyme
S9 Phosphorylation
T18 Phosphorylation
S69 Phosphorylation
Y107 Phosphorylation

Research Backgrounds

Function:

Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.

Subcellular Location:

Cytoplasm. Nucleus. Secreted.
Note: May be secreted by a non-classical secretory pathway.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Mainly expressed in stratified squamous epithelium.

Subunit Structure:

Monomer.

References

1). CRLF1 is a key regulator in the ligamentum flavum hypertrophy. Frontiers in Cell and Developmental Biology, 2020 (PubMed: 33072735) [IF=4.6]

Application: WB    Species: human    Sample: LF cells

FIGURE 6 | CRLF1 plays a crucial role in LF fibrosis. (A) CRLF1 expression induced by TGF-β1 in LF cells transfected with siRNAs. (B,C) ERK signaling pathway activation by CRLF1 and TGF-β1. (D) siCRLF1 attenuated the ERK phosphorylation induced by TGF-β1. (E) siCRLF1 reduced the fibrosis markers expression induced by TGF-β1. (F,G) Inhibition of the ERK pathway attenuated the CRLF1- and TGF-β1-induced expressions of fibrosis markers in LF cells. (H) siCRLF1 significantly reduced the pro-fibrotic effect of IL-1β (20 ng/ml). (I) siCRLF1 significantly reduced the pro-fibrotic effect of mechanical stretching forces.

Application: WB    Species: human    Sample: LF cells

FIGURE 4 | CRLF1 stimulates the cell matrix at the post-transcriptional level. LF cells were exposed to CRLF1 for 24 h. (A) Cell lysates were obtained for Western blot analysis.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.