Product: MCL1 Antibody
Catalog: AF5311
Description: Rabbit polyclonal antibody to MCL1
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Rabbit, Dog, Chicken
Mol.Wt.: 37 kDa, 50 kDa(Observed); 37kD(Calculated).
Uniprot: Q07820
RRID: AB_2837796

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(100%), Bovine(%), Horse(%), Rabbit(%), Dog(%), Chicken(%)
Clonality:
Polyclonal
Specificity:
MCL1 Antibody detects endogenous levels of total MCL1.
RRID:
AB_2837796
Cite Format: Affinity Biosciences Cat# AF5311, RRID:AB_2837796.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Bcl 2 related protein EAT/mcl1; Bcl-2-like protein 3; Bcl-2-related protein EAT/mcl1; BCL2 related; Bcl2-L-3; BCL2L3; EAT; Induced myeloid leukemia cell differentiation protein Mcl 1; Induced myeloid leukemia cell differentiation protein Mcl-1; MCL 1; MCL1; MCL1-ES; mcl1/EAT; MCL1_HUMAN; MCL1L; MCL1S; MGC104264; MGC1839; Myeloid Cell Leukemia 1; Myeloid cell leukemia ES; Myeloid cell leukemia sequence 1; Myeloid cell leukemia sequence 1 BCL2 related; Myeloid cell leukemia sequence 1 isoform 1; OTTHUMP00000032794; OTTHUMP00000032795; TM;

Immunogens

Immunogen:

A synthesized peptide derived from human MCL1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Description:
Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. Mediates its effects by interactions with a number of other regulators of apoptosis. Isoform 1 inhibits apoptosis. Isoform 2 promotes apoptosis.
Sequence:
MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Dog
100
Rabbit
94
Chicken
91
Bovine
88
Xenopus
30
Sheep
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. Mediates its effects by interactions with a number of other regulators of apoptosis. Isoform 1 inhibits apoptosis. Isoform 2 promotes apoptosis.

PTMs:

Cleaved by CASP3 during apoptosis. In intact cells cleavage occurs preferentially after Asp-127, yielding a pro-apoptotic 28 kDa C-terminal fragment.

Rapidly degraded in the absence of phosphorylation on Thr-163 in the PEST region.

Phosphorylated on Ser-159, by GSK3, in response to IL3/interleukin-3 withdrawal. Phosphorylation at Ser-159 induces ubiquitination and proteasomal degradation, abrogating the anti-apoptotic activity. Treatment with taxol or okadaic acid induces phosphorylation on additional sites.

Ubiquitinated. Ubiquitination is induced by phosphorylation at Ser-159.

Subcellular Location:

Membrane>Single-pass membrane protein. Cytoplasm. Mitochondrion. Nucleus>Nucleoplasm.
Note: Cytoplasmic, associated with mitochondria.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the Bcl-2 family.

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

References

1). Rationally designed BCR-ABL kinase inhibitors for improved leukemia treatment via covalent and pro-/dual-drug targeting strategies. Journal of advanced research, 2024 (PubMed: 39255927) [IF=11.4]

2). Novel-smoothened inhibitors for therapeutic targeting of naïve and drug-resistant hedgehog pathway-driven cancers. ACTA PHARMACOLOGICA SINICA, 2019 (PubMed: 29777201) [IF=6.9]

Application: WB    Species: mouse    Sample: NIH3T3 cells

Fig. 4|Targeting of Hh pathway function leads to downregulation of mTOR/AKT activity. a, b Serum-starved NIH3T3 cells were induced with SHH for 48h without or with the indicated inhibitors. Total cell lysates were prepared and subjected to immunoblotting as indicated. c293T cells were transfected with SMO-WT expression vector for 24h, treated with inhibitors for 48h, subjected to Annexin V-FITC/PI staining.Positive populations as analyzed by FACS are plotted. d Cells as in c were collected and immunoblotted

3). Repositioning miconazole: a novel drug for inducing cell death and differentiation in myeloid leukemia. Biochemical pharmacology, 2025 (PubMed: 40619022) [IF=5.3]

4). Inotodiol induces hepatocellular carcinoma apoptosis by activation of MAPK/ERK pathway. PloS one, 2025 (PubMed: 39879230) [IF=2.9]

5). Exploring the mechanism of Corbrin capsules in the intervention of AKI-COVID-19 based on network pharmacology combined with GEO dataset. Gene, 2024 (PubMed: 38579905) [IF=2.6]

6). Enhancing the therapeutic efficacy of gefitinib on subcutaneously transplanted SKOV3 ovarian cancer tumors in nude mice via ultrasound‑stimulated microbubble cavitation. Experimental and therapeutic medicine, 2024 (PubMed: 39006449) [IF=2.4]

7). Association of CUL4B with the pathogenesis of age-related cataract. International ophthalmology, 2024 (PubMed: 38937308) [IF=1.4]

8). Investigation of the biomarkers and mechanism based on endoplasmic reticulum stress in irritable bowel syndrome. Arab journal of gastroenterology : the official publication of the Pan-Arab Association of Gastroenterology, 2025 (PubMed: 40987697) [IF=1.1]

9). Molecular regulation of apoptotic machinery and lipid metabolism by mTORC1/mTORC2 dual inhibitors in preclinical models of HER2+/PIK3CAmut breast cancer. Oncotarget, 2016 (PubMed: 27563814)

Application: WB    Species: human    Sample:

Figure 4: The MTI-31-induced apoptosis requires Bim- and GSK3 activity. A and B. Cells of MDA-MB-453 (A) or MDAMB-231 (B) were treated as indicated. Total cell lysates were immunoblotted.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.