Claudin 4 Antibody - #AF5350
| Product: | Claudin 4 Antibody |
| Catalog: | AF5350 |
| Description: | Rabbit polyclonal antibody to Claudin 4 |
| Application: | WB IHC IF/ICC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 22 kDa; 22kD(Calculated). |
| Uniprot: | O14493 |
| RRID: | AB_2837835 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF5350, RRID:AB_2837835.
Fold/Unfold
Claudin-4; Claudin4; CLD4_HUMAN; CLDN 4; CLDN4; Clostridium perfringens enterotoxin receptor 1; Clostridium perfringens enterotoxin receptor; CPE R; CPE receptor; CPE-R; CPE-receptor; CPER; CPETR 1; CPETR; CPETR1; hCPE R; WBSCR8; Williams Beuren syndrome chromosome region 8 protein; Williams-Beuren syndrome chromosomal region 8 protein;
Immunogens
A synthesized peptide derived from human Claudin 4, corresponding to a region within C-terminal amino acids.
- O14493 CLD4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Channel-forming tight junction protein that mediates paracellular chloride transport in the kidney. Plays a critical role in the paracellular reabsorption of filtered chloride in the kidney collecting ducts. Claudins play a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Phosphorylated. Phosphorylation by EPHA2 is stimulated by EFNA1 and alters interaction with TJP1.
Cell junction>Tight junction. Cell membrane>Multi-pass membrane protein.
Note: CLDN4 is required for tight junction localization in the kidney.
Belongs to the claudin family.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Tight junction. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Organismal Systems > Immune system > Leukocyte transendothelial migration. (View pathway)
References
Application: WB Species: Mouse Sample:
Application: WB Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.