Product: MMP13 Antibody
Catalog: AF5355
Description: Rabbit polyclonal antibody to MMP13
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 54 kDa(Observed); 54kD(Calculated).
Uniprot: P45452
RRID: AB_2837840

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
MMP13 Antibody detects endogenous levels of total MMP13.
RRID:
AB_2837840
Cite Format: Affinity Biosciences Cat# AF5355, RRID:AB_2837840.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CLG 3; CLG3; Collagenase 3; Collagenase3; MANDP1; Matrix metallopeptidase 13 (collagenase 3); Matrix Metalloproteinase 13; Matrix metalloproteinase-13; MMP 13; MMP-13; Mmp13; MMP13_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human MMP13, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P45452 MMP13_HUMAN:

Detected in fetal cartilage and calvaria, in chondrocytes of hypertrophic cartilage in vertebrae and in the dorsal end of ribs undergoing ossification, as well as in osteoblasts and periosteal cells below the inner periosteal region of ossified ribs. Detected in chondrocytes from in joint cartilage that have been treated with TNF and IL1B, but not in untreated chondrocytes. Detected in T lymphocytes. Detected in breast carcinoma tissue.

Description:
Defects in MMP13 are the cause of spondyloepimetaphyseal dysplasia Missouri type (SEMD-MO) [MIM:602111]. A bone disease characterized by moderate to severe metaphyseal changes, mild epiphyseal involvement, rhizomelic shortening of the lower limbs with bowing of the femora and/or tibiae, coxa vara, genu varum and pear-shaped vertebrae in childhood. Epimetaphyseal changes improve with age.
Sequence:
MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC

Research Backgrounds

Function:

Plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC and ACAN. Cleaves triple helical collagens, including type I, type II and type III collagen, but has the highest activity with soluble type II collagen. Can also degrade collagen type IV, type XIV and type X. May also function by activating or degrading key regulatory proteins, such as TGFB1 and CCN2. Plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization and ossification. Required for normal embryonic bone development and ossification. Plays a role in the healing of bone fractures via endochondral ossification. Plays a role in wound healing, probably by a mechanism that involves proteolytic activation of TGFB1 and degradation of CCN2. Plays a role in keratinocyte migration during wound healing. May play a role in cell migration and in tumor cell invasion.

PTMs:

The proenzyme is activated by removal of the propeptide; this cleavage can be effected by other matrix metalloproteinases, such as MMP2, MMP3 and MMP14 and may involve several cleavage steps. Cleavage can also be autocatalytic, after partial maturation by another protease or after treatment with 4-aminophenylmercuric acetate (APMA) (in vitro).

N-glycosylated.

Tyrosine phosphorylated by PKDCC/VLK.

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix. Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in fetal cartilage and calvaria, in chondrocytes of hypertrophic cartilage in vertebrae and in the dorsal end of ribs undergoing ossification, as well as in osteoblasts and periosteal cells below the inner periosteal region of ossified ribs. Detected in chondrocytes from in joint cartilage that have been treated with TNF and IL1B, but not in untreated chondrocytes. Detected in T lymphocytes. Detected in breast carcinoma tissue.

Family&Domains:

The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme (By similarity).

The C-terminal region binds to collagen.

Belongs to the peptidase M10A family.

Research Fields

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Relaxin signaling pathway.

References

1). Downregulated cytotoxic CD8+ T-cell identifies with the NKG2A-soluble HLA-E axis as a predictive biomarker and potential therapeutic target in keloids. Cellular & molecular immunology, 2022 (PubMed: 35039632) [IF=21.8]

2). Microenvironment-responsive multifunctional enzyme-linked hydrogel for diabetic bone defect regeneration. Nature communications, 2025 (PubMed: 41271711) [IF=16.6]

Application: WB    Species: Rat    Sample:

Fig. 7: Functional and mechanistic insights of AAT-ZCG for DM bone defects in regulating FoxO1/P53 signaling pathways. A Volcano plot showing differentially expressed genes (DEGs) between experimental and control groups. Red dots indicate up-regulated genes, and blue dots indicate down-regulated genes. B Gene Ontology (GO) enrichment analysis of up-regulated genes. C GO enrichment analysis of down-regulated genes. D Heatmap of the expression levels of DEGs across experimental groups, with specific key genes like FoxO1 highlighted. E Kyoto encyclopedia of genes and genomes (KEGG) pathway analysis of DEGs, identifying significant pathways such as P53 signaling, FoxO1 signaling. F Schematic diagram illustrates the proposed mechanism of AAT-ZCG in activating the forkhead box O1 (FoxO1) and P53 pathways. G Western blot was conducted to evaluate the effects of AAT-ZCG on inflammation and osteogenesis through the FoxO1/P53 signaling pathway. H The effect of AAT-ZCG on the expression of FoxO1, n = 3. I The effect of AAT-ZCG on P53 expression, n = 3. J The effect of AAT-ZCG on the expression of pP53, n = 3. K The effect of AAT-ZCG on the expression of MMP13, n = 3. L The effect of AAT-ZCG on the expression of BMP2, n = 3. M) The effect of AAT-ZCG on the expression of Acp5, n = 3. Data are presented as mean ± SD. Figure 7H-M involved three biological replications (n = 3) and analysis of these experiments’ results were performed using one-way ANOVA. ns, no statistical significance. Statistical significance is indicated as follows: P 

3). Opsonization Inveigles Macrophages Engulfing Carrier-Free Bilirubin/JPH203 Nanoparticles to Suppress Inflammation for Osteoarthritis Therapy. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2024 (PubMed: 38593402) [IF=15.1]

4). Interplay between lipid dysregulation and ferroptosis in chondrocytes and the targeted therapy effect of metformin on osteoarthritis. Journal of advanced research, 2025 (PubMed: 38621621) [IF=11.4]

5). Cell Shock Absorption via Stress Relaxation Hydrogel Microspheres for Alleviating Endoplasmic Reticulum Stress in Chondrocytes. Research (Washington, D.C.), 2025 (PubMed: 40678150) [IF=11.0]

Application: IF/ICC    Species: Rat    Sample:

Fig. 4. Stressed-relaxed HAMA@Lip exhibits good biocompatibility and alleviates chondrocyte ERS and OA phenotypes. (A) CCK-8 assay results for chondrocytes treated with blank, Lip, stress-relaxed HAMA, and stress-relaxed HAMA@Lip on days 1, 2, and 3 (Blank, Lipo-Wyrgrl@TUDCA; Stress-relaxed HAMA; Stress-relaxed HAMA@Lipo). (B) Cell growth curves under different concentrations of tunicamycin. (C and D) ThT staining results and corresponding fluorescence quantification for different treatment groups (n = 3). (E and F) Col II staining results and corresponding fluorescence quantification for different treatment groups (n = 3). (G and H) Aggrecan staining results and corresponding fluorescence quantification for different treatment groups (n = 3). (I and J) MMP13 staining results and corresponding fluorescence quantification for different treatment groups (n = 3). One-way ANOVA with Tukey’s post hoc test. ns: no significance, *P < 0.05, **P < 0.01.

6). Chondrocyte-targeted bilirubin/rapamycin carrier-free nanoparticles alleviate oxidative stress and modulate autophagy for osteoarthritis therapy. Journal of controlled release : official journal of the Controlled Release Society, 2024 (PubMed: 39701459) [IF=10.8]

7). Ultrasound-responsive piezoelectric analgesic microspheres alleviate osteoarthritis pain. Journal of controlled release : official journal of the Controlled Release Society, 2025 (PubMed: 40695377) [IF=10.5]

8). HAMA-SBMA hydrogel with anti-inflammatory properties delivers cartilage organoids, boosting cartilage regeneration. Journal of nanobiotechnology, 2025 (PubMed: 40448111) [IF=10.2]

9). Varespladib-Based Lipid Nanoparticles as Highly Efficient Anti-Inflammatory Agents for Osteoarthritis Treatment. ACS applied materials & interfaces, 2025 (PubMed: 41148155) [IF=8.3]

10). Microneedles containing Cucumaria frondosa polysaccharides and 3-acetylaconitine exert analgesic, anti-inflammatory and chondroprotective activity for knee osteoarthritis. International journal of biological macromolecules, 2024 (PubMed: 39362426) [IF=8.2]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.