Hsp40 Antibody - #AF5363
| Product: | Hsp40 Antibody |
| Catalog: | AF5363 |
| Description: | Rabbit polyclonal antibody to Hsp40 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog |
| Mol.Wt.: | 38 kDa; 38kD(Calculated). |
| Uniprot: | P25685 |
| RRID: | AB_2837848 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF5363, RRID:AB_2837848.
Fold/Unfold
DnaJ (Hsp40) homolog subfmaily B member 1; DNAJ 1; DNAJ B1; DnaJ homolog subfamily B member 1; DnaJ protein homolog 1; DNAJ1; DNAJB 1; Dnajb1; DNAJB1 protein; DNJB1_HUMAN; HDJ 1; HDJ-1; HDJ1; Heat shock 40 kDa protein 1; Heat shock 40kD protein 1; Heat shock protein 40; Hsp 40; HSP40; HSPF 1; HSPF1; Human DnaJ protein 1; Radial spoke 16 homolog B; RSPH16B; Sis1;
Immunogens
A synthesized peptide derived from human Hsp40, corresponding to a region within C-terminal amino acids.
- P25685 DNJB1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP. Negatively regulates heat shock-induced HSF1 transcriptional activity during the attenuation and recovery phase period of the heat shock response. Stimulates ATP hydrolysis and the folding of unfolded proteins mediated by HSPA1A/B (in vitro).
Cytoplasm. Nucleus. Nucleus>Nucleolus.
Note: Translocates rapidly from the cytoplasm to the nucleus, and especially to the nucleoli, upon heat shock.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)
· Human Diseases > Infectious diseases: Viral > Influenza A.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.