Product: Phospho-CD3 zeta (Tyr142) Antibody
Catalog: AF5425
Description: Rabbit polyclonal antibody to Phospho-CD3 zeta (Tyr142)
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse
Prediction: Pig, Bovine, Horse, Sheep, Rabbit
Mol.Wt.: 19 kDa(Observed); 19kD(Calculated).
Uniprot: P20963
RRID: AB_2837909

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Prediction:
Pig(100%), Bovine(100%), Horse(83%), Sheep(92%), Rabbit(92%)
Clonality:
Polyclonal
Specificity:
Phospho-CD3 zeta (Tyr142) Antibody detects endogenous levels of CD3 zeta only when phosphorylated at Tyr142.
RRID:
AB_2837909
Cite Format: Affinity Biosciences Cat# AF5425, RRID:AB_2837909.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

4930549J05Rik; A430104F18Rik; AW552088; CD247; CD247 antigen; Cd247 molecule; Cd3; CD3 antigen, zeta polypeptide, isoform CRA_b; CD3 antigen, zeta subunit; CD3-eta; CD3H; CD3Q; Cd3z; CD3Z antigen zeta polypeptide (TiT3 complex); CD3Z_HUMAN; CD3zeta; CD3zeta chain; MGC140430; T cell receptor T3 zeta chain; T cell surface glycoprotein CD3 zeta chain; T-cell antigen receptor complex, zeta subunit of CD3; T-cell receptor T3 zeta chain; T-cell surface glycoprotein CD3 zeta chain; T3z; TCR zeta chain; TCRk; TCRZ; TCRzeta;

Immunogens

Immunogen:

A synthesized peptide derived from human CD3 ζ around the phosphorylation site of Tyr142.

Uniprot:
Gene(ID):
Expression:
P20963 CD3Z_HUMAN:

CD3Z is expressed in normal lymphoid tissue and in peripheral blood mononuclear cells (PBMCs) (PubMed:11722641).

Description:
Defects in CD3D are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (T(-)/B(+)/NK(+) SCID) [MIM:608971]. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels.
Sequence:
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Sheep
92
Rabbit
92
Horse
83
Chicken
67
Zebrafish
64
Xenopus
55
Dog
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. CD3Z ITAMs phosphorylation creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Plays an important role in intrathymic T-cell differentiation. Additionally, participates in the activity-dependent synapse formation of retinal ganglion cells (RGCs) in both the retina and dorsal lateral geniculate nucleus (dLGN) (By similarity).

PTMs:

Phosphorylated on Tyr residues after T-cell receptor triggering by LCK in association with CD4/CD8.

Subcellular Location:

Membrane>Single-pass type I membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

CD3Z is expressed in normal lymphoid tissue and in peripheral blood mononuclear cells (PBMCs).

Family&Domains:

The ITAM domains mediate interaction with SHB.

Belongs to the CD3Z/FCER1G family.

Research Fields

· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).

· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.   (View pathway)

· Organismal Systems > Immune system > Th1 and Th2 cell differentiation.   (View pathway)

· Organismal Systems > Immune system > Th17 cell differentiation.   (View pathway)

· Organismal Systems > Immune system > T cell receptor signaling pathway.   (View pathway)

References

1). Circulating tumor cells shielded with extracellular vesicle-derived CD45 evade T cell attack to enable metastasis. Signal transduction and targeted therapy, 2024 (PubMed: 38575583) [IF=40.8]

Application: WB    Species: Human    Sample:

Fig. 7 CD45 on tumor cells attenuates TCR signaling. a Immunoblot analysis for TCR signaling of Jurkat cells after activation with OKT3 (1 μg/mL) and cocultured with DLD1 cells overexpressing CD45 isoforms for 5 min. b Ca2+ influx of Jurkat cells after OKT3 (5 μg/mL) stimulation and cocultured with DLD1 cells with or without CD45 overexpression. c Immunofluorescence images of Jurkat cells after activation with OKT3 (1 μg/mL) and cocultured with DLD1 cells with or without CD45 overexpression for 5 min. Pearson’s correlation coefficient characterizes the colocalization of CD3ε (green) and CD45 (purple), each point represents one cell. Scale bar = 5 μm. d Immunoblot analysis for HLA-ABC expression of Caco2 cells overexpressing different CD45 isoforms. e Flow cytometric analysis of HLA-A2 expression on Caco2 cells. f Flow cytometric isolation of HLA-A2+ CD3+ T cells from PBMCs of healthy donors. g Immunoblot analysis for TCR signaling of HLA-A2+ CD3+ T cells after activation with OKT3 (1 μg/mL) and cocultured with Caco2 cells with or without CD45 overexpression within 5 min. h Immunoblot analysis for NY-ESO-1 expression in Caco2 cells after the indicated manipulation. i Immunoblot analysis for TCR signaling of Jurkat-TCR cells after activation with OKT3 (1 μg/mL) and cocultured with Caco2-NYESO1 cells with or without CD45 overexpression within 5 min. j Ca2+ influx of Jurkat-TCR cells after OKT3 (5 μg/mL) stimulation in the presence of Caco2-NYESO1 cells with or without overexpression of CD45 isoforms. k IL-2 secretion of Jurkat-TCR cells after cocultured with Caco2-NYESO1 cells with or without CD45 overexpression for 16 h. l Flow cytometric analysis of CD69 expression on Jurkat-TCR cells when cocultured with Caco2-NYESO1 cells with or without CD45 overexpression for 16 h. m, n CD45 exclusion from the immune synapse (IS) on Jurkat-TCR cells or CD8+ T-TCR cells in contact with Caco2-NYESO1 cells with or without CD45 overexpression after 5 min of activation with OKT3 (1 μg/mL), fixed, stained with anti-CD45 and anti-flag antibody. The exclusion percentage = (1-ICD45 in IS zone/ICD45 out IS zone) × 100%. I means intensity. Data are presented as median with 95% CI. Scale bar = 10 μm. o Schematic diagram showing the experimental setup for the investigation of the intercellular CD45-CD45 homophilic interactions. The co-immunoprecipitation data below illustrates the homophilic CD45-CD45 interactions in the cell model. p Immunofluorescence images showing the intercellular CD45-CD45 homophilic interactions detected by proximity ligation assay. Scale bar = 10 μm. q Schematic diagram showing the experimental setup for the investigation of the intercellular CD45-CD45 homophilic interactions. The co-immunoprecipitation data below illustrates the homophilic CD45-CD45 interactions between Caco2 cells overexpressing HA-CD45 and Jurkat-sgCD45-CD45GFP cells. r Immunofluorescence images showing the intercellular CD45-CD45 homophilic interactions detected by proximity ligation assay. Scale bar = 10 μm. s Predicted crystal structure of CD45-CD45 interactions using ZDOCK. t The proximity ligation assay and (u) the co-immunoprecipitation data showing the homophilic CD45-CD45 interactions between HEK293T-HA-CD45 and HEK293T-MYC-CD45 cells with or without CD45 truncation of amino sites 430–436. Scale bar = 10 μm. v Schematic diagram showing the regulation of the TCR-pMHC complex and the potential immuno-modulatory role of CD45-CD45 dimerization between tumor cells and T cells. Unless otherwise specified, all bar graph data are presented as means ± SEM. *P 

2). Injectable Hydrogel-Encapsulating Pickering Emulsion for Overcoming Lenvatinib-Resistant Hepatocellular Carcinoma via Cuproptosis Induction and Stemness Inhibition. Polymers, 2024 (PubMed: 39274051) [IF=5.0]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.