Product: MDK Antibody
Catalog: DF6054
Description: Rabbit polyclonal antibody to MDK
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Sheep, Chicken, Xenopus
Mol.Wt.: 16kDa; 16kD(Calculated).
Uniprot: P21741
RRID: AB_2838023

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Sheep(100%), Chicken(88%), Xenopus(88%)
Clonality:
Polyclonal
Specificity:
MDK Antibody detects endogenous levels of total MDK.
RRID:
AB_2838023
Cite Format: Affinity Biosciences Cat# DF6054, RRID:AB_2838023.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Amphiregulin associated protein; Amphiregulin-associated protein; ARAP; FLJ27379; Mdk; Midgestation and kidney protein; Midkine; MK 1; MK; MK_HUMAN; MK1; NEGF 2; NEGF2; Neurite growth promoting factor 2; Neurite outgrowth promoting protein; Neurite outgrowth-promoting factor 2; Neurite outgrowth-promoting protein; Retinoic acid inducible factor;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P21741 MK_HUMAN:

Expressed in various tumor cell lines. In insulinoma tissue predominantly expressed in precancerous lesions.

Description:
Midkine, or MK, is a heparin-binding molecule involved in the regulation of growth and differentiation during embryogenesis. MK expression is tightly regulated during embryonic development by steroid receptors of the retinoic acid superfamily. The mature human MK protein is 118 amino acids in length and contains five intrachain disulfide bonds. MK is a non-glycosylated protein that shows greater than 87% identity between human and mouse. The carboxy-terminus of MK contains the principle heparin-binding site and the molecule’s neurite-promoting sequences; both the amino- and carboxy-terminal sequences are required for the molecule’s neurotrophic properties. An association between overexpression of MK and colon adenocarcinoma has been shown in families suffering from familial polyposis. In addition, MK functions to enhance the activity of plasminogen activator (PA).
Sequence:
MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Sheep
100
Xenopus
88
Chicken
88
Horse
0
Dog
0
Zebrafish
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P21741 As Substrate

Site PTM Type Enzyme
K101 Acetylation
K108 Acetylation
T119 O-Glycosylation

Research Backgrounds

Function:

Secreted protein that functions as cytokine and growth factor and mediates its signal through cell-surface proteoglycan and non-proteoglycan receptors. Binds cell-surface proteoglycan receptors via their chondroitin sulfate (CS) groups. Thereby regulates many processes like inflammatory response, cell proliferation, cell adhesion, cell growth, cell survival, tissue regeneration, cell differentiation and cell migration. Participates in inflammatory processes by exerting two different activities. Firstly, mediates neutrophils and macrophages recruitment to the sites of inflammation both by direct action by cooperating namely with ITGB2 via LRP1 and by inducing chemokine expression. This inflammation can be accompanied by epithelial cell survival and smooth muscle cell migration after renal and vessel damage, respectively. Secondly, suppresses the development of tolerogenic dendric cells thereby inhibiting the differentiation of regulatory T cells and also promote T cell expansion through NFAT signaling and Th1 cell differentiation. Promotes tissue regeneration after injury or trauma. After heart damage negatively regulates the recruitment of inflammatory cells and mediates cell survival through activation of anti-apoptotic signaling pathways via MAPKs and AKT pathways through the activation of angiogenesis (By similarity). Also facilitates liver regeneration as well as bone repair by recruiting macrophage at trauma site and by promoting cartilage development by facilitating chondrocyte differentiation (By similarity). Plays a role in brain by promoting neural precursor cells survival and growth through interaction with heparan sulfate proteoglycans (By similarity). Binds PTPRZ1 and promotes neuronal migration and embryonic neurons survival. Binds SDC3 or GPC2 and mediates neurite outgrowth and cell adhesion. Binds chondroitin sulfate E and heparin leading to inhibition of neuronal cell adhesion induced by binding with GPC2. Binds CSPG5 and promotes elongation of oligodendroglial precursor-like cells (By similarity). Also binds ITGA6:ITGB1 complex; this interaction mediates MDK-induced neurite outgrowth. Binds LRP1; promotes neuronal survival. Binds ITGA4:ITGB1 complex; this interaction mediates MDK-induced osteoblast cells migration through PXN phosphorylation. Binds anaplastic lymphoma kinase (ALK) which induces ALK activation and subsequent phosphorylation of the insulin receptor substrate (IRS1), followed by the activation of mitogen-activated protein kinase (MAPK) and PI3-kinase, and the induction of cell proliferation. Promotes epithelial to mesenchymal transition through interaction with NOTCH2. During arteriogenesis, plays a role in vascular endothelial cell proliferation by inducing VEGFA expression and release which in turn induces nitric oxide synthase expression. Moreover activates vasodilation through nitric oxide synthase activation (By similarity). Negatively regulates bone formation in response to mechanical load by inhibiting Wnt/beta-catenin signaling in osteoblasts (By similarity). In addition plays a role in hippocampal development, working memory, auditory response, early fetal adrenal gland development and the female reproductive system (By similarity).

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in various tumor cell lines. In insulinoma tissue predominantly expressed in precancerous lesions.

Subunit Structure:

Homodimer. Interacts with ALK. Interacts with LRP1; promotes neuronal survival. Interacts with LRP2. Interacts with NCAM1. Interacts (via C-terminal) with PTPRZ1 (via chondroitin sulfate chains); this interaction is inhibited by PTN; this interaction promotes neuronal migration. Interacts with NCL; this interaction promotes NCL clustering and lateral movements of this complex into lipid rafts leading to MDK internalization. Interacts with LRP6 and LRP8: this interaction is calcium dependent. Interacts with ITGA4. Interacts with ITGA6. Interacts with ITGB1. Interacts with ITGA4:ITGB1 complex; this interaction mediates MDK-induced osteoblast cells migration through PXN phosphorylation. Interacts with ITGA6:ITGB1 complex; this interaction mediates MDK-induced neurite outgrowth. Interacts with NOTCH2; this interaction mediates a nuclear accumulation of NOTCH2 and therefore activation of NOTCH2 signaling leading to interaction between HES1 and STAT3. Interacts with GPC2 (via heparan sulfate chain); this interaction is inhibited by heparin followed by chondroitin sulfate E; this interaction induces GPC2 clustering through heparan sulfate chain; this interaction induces neuronal cell adhesion and neurite outgrowth. Interacts with SDC3; this interaction induces SDC3 clustering; this interaction induces neuronal cell adhesion and neurite outgrowth. Interacts with SDC1 (By similarity). Interacts with CSPG5; this interaction promotes elongation of oligodendroglial precursor-like cells (By similarity).

Family&Domains:

Belongs to the pleiotrophin family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.