TCL1A Antibody - #DF6112
Product: | TCL1A Antibody |
Catalog: | DF6112 |
Description: | Rabbit polyclonal antibody to TCL1A |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Rabbit |
Mol.Wt.: | 13kDa; 13kD(Calculated). |
Uniprot: | P56279 |
RRID: | AB_2838079 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6112, RRID:AB_2838079.
Fold/Unfold
Anti TCL1A; Lymphoma/leukemia, T-cell; Oncogene TCL-1; Oncogene TCL1; P14 TCL1; P14 TCL1 protein; Protein p14 TCL1; T cell leukemia 1; T cell lymphoma 1; T cell lymphoma 1A; T-cell leukemia/lymphoma 1A; T-cell leukemia/lymphoma protein 1A; TCL 1 protein; TCL1; TCL1 oncogene; TCL1 PEN; Tcl1a; TCL1A antibody; TCL1A_HUMAN;
Immunogens
A synthesized peptide derived from human TCL1A, corresponding to a region within the internal amino acids.
Restricted in the T-cell lineage to immature thymocytes and activated peripheral lymphocytes. Preferentially expressed early in T- and B-lymphocyte differentiation.
- P56279 TCL1A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Enhances the phosphorylation and activation of AKT1, AKT2 and AKT3. Promotes nuclear translocation of AKT1. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival.
Cytoplasm. Nucleus. Microsome. Endoplasmic reticulum.
Note: Microsomal fraction.
Restricted in the T-cell lineage to immature thymocytes and activated peripheral lymphocytes. Preferentially expressed early in T- and B-lymphocyte differentiation.
Belongs to the TCL1 family.
Research Fields
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.