Product: S100B Antibody
Catalog: DF6116
Description: Rabbit polyclonal antibody to S100B
Application: WB IHC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 11kDa(Observed); 11kD(Calculated).
Uniprot: P04271
RRID: AB_2838083

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(89%)
Clonality:
Polyclonal
Specificity:
S100B Antibody detects endogenous levels of total S100B.
RRID:
AB_2838083
Cite Format: Affinity Biosciences Cat# DF6116, RRID:AB_2838083.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

NEF; Protein S100 B; Protein S100-B; S 100 calcium binding protein beta chain; S 100 protein beta chain; S-100 protein beta chain; S-100 protein subunit beta; S100; S100 calcium binding protein beta (neural); S100 calcium-binding protein B; S100 protein beta chain; S100B; S100B_HUMAN; S100beta;

Immunogens

Immunogen:

A synthesized peptide derived from human S100B, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P04271 S100B_HUMAN:

Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues.

Description:
Despite their relatively small size (8-12 kDa) and uncomplicated architecture, S100 proteins regulate a variety of cellular processes such as cell growth and motility, cell cycle progression, transcription, and differentiation. To date, 25 members have been identified, including S100A1-S100A18, trichohyalin, filaggrin, repetin, S100P, and S100Z, making it the largest group in the EF-hand, calcium-binding protein family. Interestingly, 14 S100 genes are clustered on human chromosome 1q21, a region of genomic instability. Research studies have demonstrated that significant correlation exists between aberrant S100 protein expression and cancer progression. S100 proteins primarily mediate immune responses in various tissue types but are also involved in neuronal development (1-4).Each S100 monomer bears two EF-hand motifs and can bind up to two molecules of calcium (or other divalent cation in some instances). Structural evidence shows that S100 proteins form antiparallel homo- or heterodimers that coordinate binding partner proximity in a calcium-dependent (and sometimes calcium-independent) manner. Although structurally and functionally similar, individual members show restricted tissue distribution, are localized in specific cellular compartments, and display unique protein binding partners, which suggests that each plays a specific role in various signaling pathways. In addition to an intracellular role, some S100 proteins have been shown to act as receptors for extracellular ligands or are secreted and exhibit cytokine-like activities (1-4). S100B is abundantly expressed in astrocytes and is commonly used as an astrocytic marker in studies of the mammalian CNS. S100B is also expressed in immature and mature myelinating oligodendrocytes that are chondroitin sulfate proteoglycan (NG2)-positive (5).
Sequence:
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Zebrafish
100
Rabbit
100
Chicken
89
Xenopus
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity.

Subcellular Location:

Cytoplasm. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues.

Family&Domains:

Belongs to the S-100 family.

References

1). Magnetic Microbubbles Combined with ICG-Loaded Liposomes for Synergistic Mild-Photothermal and Ferroptosis-Enhanced Photodynamic Therapy of Melanoma. International journal of nanomedicine, 2025 (PubMed: 40093542) [IF=6.6]

2). Mangiferin attenuates lipopolysaccharide-induced neuronal injuries in primary cultured hippocampal neurons. Aging, 2024 (PubMed: 38752883) [IF=3.9]

Application: WB    Species: Mouse    Sample:

Figure 9. Mangiferin eliminates pathogenic proteins and elevates neuroprotective factors in LPS-challenged cells by Western blot. (A) Western blot showed the protein level of Aβ42, p-tau, S100β, NSE, APJ, and VEGF change with different treatments. (B–G) Quantitative analysis of A, protein levels of Aβ42 in LPS, 20 μmol/L mangiferin with LPS, 40 μmol/L mangiferin with LPS compared to control were 2.10, 1.67, and 1.30 times, respectively, all ***P < 0.001. One-way ANOVA, F = 111.7, ***P < 0.001. Protein levels of p-tau in LPS, 20 μmol/L mangiferin with LPS, 40 μmol/L mangiferin with LPS compared to the control are 2.60, 1.94, and 1.53 times, respectively, all ***P < 0.001. One-way ANOVA, F = 285.7, ***P < 0.001. Protein levels of S100β in LPS, 20 μmol/L mangiferin with LPS, and 40 μmol/L mangiferin with LPS compared to the control are 2.11, 1.61, and 1.38 times, respectively, **P = 0.0026 for 20 μmol/L mangiferin with LPS vs. 40 μmol/L mangiferin with LPS. One-way ANOVA, F = 241.0, ***P < 0.001. Protein levels of NSE in LPS, 20 μmol/L mangiferin with LPS, 40 μM mangiferin with LPS compared to the control are 3.57, 2.27, and 1.67 times, respectively, all ***P < 0.001. One-way ANOVA, F = 990.9, ***P < 0.001. Protein levels of APJ in LPS, 20 μmol/L mangiferin with LPS, 40 μmol/L mangiferin with LPS compared to control are 0.45, 0.63, and 0.82 in fold, respectively, **P = 0.0028 for LPS vs. 20 μmol/L mangiferin with LPS, **P = 0.0015 for 20 μmol/L mangiferin with LPS vs. 40 μmol/L mangiferin with LPS. One-way ANOVA, F = 108.3, ***P < 0.001. Protein levels of VEGF in LPS, 20 μmol/L mangiferin with LPS, 40 μM mangiferin with LPS compared to control were 0.43, 0.57, and 0.79 times, respectively, all ***P < 0.001. One-way ANOVA, F = 467.7, ***P < 0.001.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.