Product: SNAI2 Antibody
Catalog: DF6202
Description: Rabbit polyclonal antibody to SNAI2
Application: WB IHC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 30kDa(Observed); 30kD(Calculated).
Uniprot: O43623
RRID: AB_2838168

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(100%), Zebrafish(%), Bovine(%), Horse(%), Sheep(%), Rabbit(%), Dog(%), Chicken(%), Xenopus(%)
Clonality:
Polyclonal
Specificity:
SNAI2 Antibody detects endogenous levels of total SNAI2.
RRID:
AB_2838168
Cite Format: Affinity Biosciences Cat# DF6202, RRID:AB_2838168.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

dJ710H13.1; MGC10182; Neural crest transcription factor Slug; Protein sna; Protein snail homolog 1; Protein snail homolog 2; Protein snail homolog; Slug homolog zinc finger protein; Slug zinc finger protein; SLUGH; SLUGH 1; SLUGH1; SLUGH2; SNA; Sna protein; SNAH; SNAI 2; snai1; SNAI1_HUMAN; Snai2; SNAI2_HUMAN; Snail 2; Snail homolog 1 (Drosophila); Snail homolog 2; Snail2; WS 2D; WS2D; Zinc finger protein SLUG; Zinc finger protein SNAI1; Zinc finger protein SNAI2;

Immunogens

Immunogen:

A synthesized peptide derived from human SNAI2, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
O43623 SNAI2_HUMAN:

Expressed in most adult human tissues, including spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Not detected in peripheral blood leukocyte. Expressed in the dermis and in all layers of the epidermis, with high levels of expression in the basal layers (at protein level). Expressed in osteoblasts (at protein level). Expressed in mesenchymal stem cells (at protein level). Expressed in breast tumor cells (at protein level).

Description:
Slug (SNAI2) is a widely expressed transcriptional repressor and member of the Snail family of zinc finger transcription factors (1). Similar to the related Snail protein, Slug binds to the E-cadherin promoter region to repress transcription during development (2). The binding of Slug to integrin promoter sequences represses integrin expression and results in reduced cell adhesion (3). Down regulation of E-cadherin expression occurs during the epithelial-mesenchymal transition during embryonic development, a process also exploited by invasive cancer cells (4,5). The tumor suppressor protein p53 induces Slug expression in γ-irradiated cells; Slug protects damaged cells from apoptosis by repressing p53-induced transcription of the proapoptotic Bcl-2 family protein Puma (6). Deletion mutations in the corresponding Slug gene are associated with the pigmentation disorders Waardenburg Syndrome and Piebaldism, while a genetic duplication resulting in Slug overexpression is associated with a collection of congenital heart defects termed tetralogy of Fallot (7).
Sequence:
MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Zebrafish
100
Chicken
100
Rabbit
100
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Transcriptional repressor that modulates both activator-dependent and basal transcription. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1-induced transcriptional repression of the TJ protein, occludin (OCLN) and subsequent oncogenic transformation of epithelial cells (By similarity). Represses BRCA2 expression by binding to its E2-box-containing silencer and recruiting CTBP1 and HDAC1 in breast cells. In epidermal keratinocytes, binds to the E-box in ITGA3 promoter and represses its transcription. Involved in the regulation of ITGB1 and ITGB4 expression and cell adhesion and proliferation in epidermal keratinocytes. Binds to E-box2 domain of BSG and activates its expression during TGFB1-induced epithelial-mesenchymal transition (EMT) in hepatocytes. Represses E-Cadherin/CDH1 transcription via E-box elements. Involved in osteoblast maturation. Binds to RUNX2 and SOC9 promoters and may act as a positive and negative transcription regulator, respectively, in osteoblasts. Binds to CXCL12 promoter via E-box regions in mesenchymal stem cells and osteoblasts. Plays an essential role in TWIST1-induced EMT and its ability to promote invasion and metastasis.

PTMs:

GSK3B-mediated phosphorylation results in cytoplasmic localization and degradation.

Subcellular Location:

Nucleus. Cytoplasm.
Note: Observed in discrete foci in interphase nuclei. These nuclear foci do not overlap with the nucleoli, the SP100 and the HP1 heterochromatin or the coiled body, suggesting SNAI2 is associated with active transcription or active splicing regions.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in most adult human tissues, including spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Not detected in peripheral blood leukocyte. Expressed in the dermis and in all layers of the epidermis, with high levels of expression in the basal layers (at protein level). Expressed in osteoblasts (at protein level). Expressed in mesenchymal stem cells (at protein level). Expressed in breast tumor cells (at protein level).

Family&Domains:

Repression activity depends on the C-terminal DNA-binding zinc fingers and on the N-terminal repression domain.

Belongs to the snail C2H2-type zinc-finger protein family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Adherens junction.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

References

1). Glycated ECM Derived Carbon Dots Inhibit Tumor Vasculogenic Mimicry by Disrupting RAGE Nuclear Translocation and Its Interaction With HMGB1. Advanced materials (Deerfield Beach, Fla.), 2025 (PubMed: 40159891) [IF=27.4]

2). USP5 promotes epithelial-mesenchymal transition by stabilizing SLUG in hepatocellular carcinoma. Theranostics, 2019 (PubMed: 30809294) [IF=12.4]

Application: WB    Species: human    Sample: PLC-PRF-5 and Hep3B tumor

Figure 6.| Formononetin inhibits EMT of hepatocellular carcinoma. (P) USP5, SLUG, Vimentin and E-cadherin were detected by Western blotting in PLC-PRF-5 and Hep3B tumor tissues of each group. Error bars represent mean ± SD, *P<0.05, **P<0.01.

Application: IHC    Species: mouse    Sample: tumors tissues

Figure 6.| Formononetin inhibits EMT of hepatocellular carcinoma. (O) IHC analysis of USP5, SLUG, E-cadherin, Vimentin and Ki67 in tumors tissues. Representative images and staining scores are shown. Scale bar, 50 µm. (P) USP5, SLUG, Vimentin and E-cadherin were detected by Western blotting in PLC-PRF-5 and Hep3B tumor tissues of each group. Error bars represent mean ± SD, *P<0.05, **P<0.01.

3). γ-Glutamyl cyclotransferase contributes to endometrial carcinoma malignant progression and upregulation of PD-L1 expression during activation of epithelial-mesenchymal transition. International Immunopharmacology, 2020 (PubMed: 31757677) [IF=4.8]

Application: WB    Species: Human    Sample: endometrial carcinoma cells

Fig. 4. GGCT contributed to malignant biological behaviors of endometrial carcinoma cells during EMT activation. The expression of the EMT markers E-cadherin, N- cadherin, Vimentin, Twist, Snail, and Slug detected using western blot demonstrated the contribution of GGCT to the EMT process in endometrial carcinoma. This analysis was repeated three times (A, B). Immunohistochemical staining of the EMT markers E-cadherin, N-cadherin, Vimentin, Twist, Snail, and Slug in tumor tissues from the xenograft model demonstrated the contribution of GGCT to the EMT process in vivo (C). *p < 0.05.

Application: IHC    Species: Human    Sample: endometrial carcinoma cells

Fig. 4. GGCT contributed to malignant biological behaviors of endometrial carcinoma cells during EMT activation. The expression of the EMT markers E-cadherin, N- cadherin, Vimentin, Twist, Snail, and Slug detected using western blot demonstrated the contribution of GGCT to the EMT process in endometrial carcinoma. This analysis was repeated three times (A, B). Immunohistochemical staining of the EMT markers E-cadherin, N-cadherin, Vimentin, Twist, Snail, and Slug in tumor tissues from the xenograft model demonstrated the contribution of GGCT to the EMT process in vivo (C). *p < 0.05.

Application: WB    Species: Mice    Sample: tumor tissues

Fig. 4. GGCT contributed to malignant biological behaviors of endometrial carcinoma cells during EMT activation. The expression of the EMT markers E-cadherin, Ncadherin, Vimentin, Twist, Snail, and Slug detected using western blot demonstrated the contribution of GGCT to the EMT process in endometrial carcinoma. This analysis was repeated three times (A, B). Immunohistochemical staining of the EMT markers E-cadherin, N-cadherin, Vimentin, Twist, Snail, and Slug in tumor tissues from the xenograft model demonstrated the contribution of GGCT to the EMT process in vivo (C). *p < 0.05.

Application: IHC    Species: Mice    Sample: tumor tissues

Fig. 4. GGCT contributed to malignant biological behaviors of endometrial carcinoma cells during EMT activation. The expression of the EMT markers E-cadherin, Ncadherin, Vimentin, Twist, Snail, and Slug detected using western blot demonstrated the contribution of GGCT to the EMT process in endometrial carcinoma. This analysis was repeated three times (A, B). Immunohistochemical staining of the EMT markers E-cadherin, N-cadherin, Vimentin, Twist, Snail, and Slug in tumor tissues from the xenograft model demonstrated the contribution of GGCT to the EMT process in vivo (C). *p < 0.05.

4). Cod (Gadus) skin collagen peptide powder reduces inflammation, restores mucosal barrier function, and inhibits fibrosis in dextran sodium sulfate-induced colitis in mice. JOURNAL OF ETHNOPHARMACOLOGY, 2023 (PubMed: 37277083) [IF=4.8]

5). METTL3-dependent m6A modification facilitates decreased endometrial decidualization via attenuation of MET in endometriosis. Reproduction (Cambridge, England), 2024 (PubMed: 38781072) [IF=3.7]

Application: WB    Species: human    Sample:

Figure 1 MET formation is related to decidualization in endometrial stromal cells. (A–D) NESCs were induced by a decidualization in vitro. (A, B) mRNA levels of PRL and IGFBP1 were examined by qRT-PCR. (C) Cytoskeleton staining to determine the cellular morphology of NESCs. (D) Representative Western blot analysis showing the levels of E-cadherin, vimentin, and Slug. Data presented are from three independent experiments (*P < 0.05, *** P < 0.001 compared to the day 0 group, n = 6).

Application: IHC    Species: human    Sample:

Figure 2 Impaired MET formation is related to decidualization failure in endometriosis. (A) Representative photomicrographs of E-cadherin, vimentin, and Slug expression in normal control endometrium (NC) and eutopic endometrium of endometriosis (EU). (B–D) IHC scores of E-cadherin, vimentin, and Slug in NC and EU. (E–J) NESCs and EESCs were induced by a decidualization protocol in vitro. (E and D) mRNA levels of PRL and IGFBP1 were examined by qRT-PCR. (G) Representative Western blot analysis showing the levels of E-cadherin, vimentin, and Slug. Data presented are from three independent experiments (# P < 0.05, ## P < 0.01 compared to the normal control group; *P < 0.05 compared to the NESCs group; IHC: NC = 14, EU = 13; Cell experiments: n = 4).

6). FTO Upregulates GLG1 Expression via m6A Methylation Modification to Facilitate Gastric Cancer Cell Migration and Invasion. Journal of gastroenterology and hepatology, 2025 (PubMed: 41287415) [IF=3.7]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.