FAM3B Antibody - #DF6227
Product: | FAM3B Antibody |
Catalog: | DF6227 |
Description: | Rabbit polyclonal antibody to FAM3B |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 26kDa; 26kD(Calculated). |
Uniprot: | P58499 |
RRID: | AB_2838193 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6227, RRID:AB_2838193.
Fold/Unfold
2-21; C21orf11; C21orf76; Cytokine like protein 2 21; Cytokine-like protein 2-21; Fam3b; FAM3B_HUMAN; Family with sequence similarity 3 member B; ORF9; Pancreatic-derived factor; PANDER; PRED44; Protein FAM3B;
Immunogens
Highly expressed in the pancreas. Also found in the colon, kidney, prostate, small intestine and testis.
- P58499 FAM3B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
PTMs - P58499 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S43 | Phosphorylation | Uniprot | |
S80 | Phosphorylation | Uniprot |
Research Backgrounds
Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.
2 N-termini have been observed in the mature protein: the first at Glu-30, resulting from signal peptide cleavage, the second at Ser-46.
O-glycosylated.
Secreted.
Note: Present in insulin secretory granules and likely cosecreted with insulin. Localized in discrete vesicular and perinuclear structure.
Highly expressed in the pancreas. Also found in the colon, kidney, prostate, small intestine and testis.
Belongs to the FAM3 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.