NEDD8 Antibody - #DF6297
| Product: | NEDD8 Antibody |
| Catalog: | DF6297 |
| Description: | Rabbit polyclonal antibody to NEDD8 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 9kDa; 9kD(Calculated). |
| Uniprot: | Q15843 |
| RRID: | AB_2838263 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6297, RRID:AB_2838263.
Fold/Unfold
FLJ43224; MGC104393; MGC125896; MGC125897; NED8; NEDD 8; NEDD-8; Nedd8; NEDD8_HUMAN; Neddylin; Neural precursor cell expressed developmentally down regulated 8; Neural precursor cell expressed developmentally down regulated gene 8; Neural precursor cell expressed developmentally down-regulated protein 8; Rub1; Ubiquitin like protein Nedd 8; Ubiquitin like protein Nedd8; Ubiquitin-like protein Nedd8;
Immunogens
A synthesized peptide derived from human NEDD8, corresponding to a region within the internal amino acids.
Highly expressed in heart, skeletal muscle, spleen, thymus, prostate, testis, ovary, colon and leukocytes.
- Q15843 NEDD8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.
Cleavage of precursor form by UCHL3 or SENP8 is necessary for function.
Nucleus.
Note: Mainly nuclear.
Highly expressed in heart, skeletal muscle, spleen, thymus, prostate, testis, ovary, colon and leukocytes.
Belongs to the ubiquitin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.