KCNE1 Antibody - #DF6310
Product: | KCNE1 Antibody |
Catalog: | DF6310 |
Description: | Rabbit polyclonal antibody to KCNE1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep |
Mol.Wt.: | 15kDa; 15kD(Calculated). |
Uniprot: | P15382 |
RRID: | AB_2838276 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6310, RRID:AB_2838276.
Fold/Unfold
Delayed rectifier potassium channel subunit IsK; Human cardiac delayed rectifier potassium channel protein; IKs producing slow voltage gated potassium channel subunit beta Mink; IKs producing slow voltage-gated potassium channel subunit beta Mink; ISK; JLNS 2; JLNS; JLNS2; KCNE 1; KCNE1; KCNE1_HUMAN; LQT 5; LQT5; MGC33114; Minimal potassium channel; MinK; Potassium voltage gated channel Isk related family member 1; Potassium voltage gated channel Isk related subfamily member 1; Potassium voltage gated channel subfamily E member 1; Potassium voltage-gated channel subfamily E member 1;
Immunogens
A synthesized peptide derived from human KCNE1, corresponding to a region within the internal amino acids.
Expressed in lung, kidney, testis, ovaries, small intestine, peripheral blood leukocytes. Expressed in the heart (PubMed:19219384). Not detected in pancreas, spleen, prostate and colon. Restrictively localized in the apical membrane portion of epithelial cells.
- P15382 KCNE1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. Assembled with KCNQ1/KVLQT1 is proposed to form the slowly activating delayed rectifier cardiac potassium (IKs) channel. The outward current reaches its steady state only after 50 seconds. Assembled with KCNH2/HERG may modulate the rapidly activating component of the delayed rectifying potassium current in heart (IKr).
Phosphorylation inhibits the potassium current.
N-glycosylation at Asn-26 occurs post-translationally, and requires prior cotranslational glycosylation at Asn-5.
Cell membrane>Single-pass type I membrane protein. Apical cell membrane. Membrane raft.
Note: Colocalizes with KCNB1 at the plasma membrane (By similarity). Targets to the membrane raft when associated with KCNQ1 (PubMed:20533308).
Expressed in lung, kidney, testis, ovaries, small intestine, peripheral blood leukocytes. Expressed in the heart. Not detected in pancreas, spleen, prostate and colon. Restrictively localized in the apical membrane portion of epithelial cells.
Belongs to the potassium channel KCNE family.
Research Fields
· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.