Product: KCNE1 Antibody
Catalog: DF6310
Description: Rabbit polyclonal antibody to KCNE1
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep
Mol.Wt.: 18-35kD(Observed); 15kD(Calculated).
Uniprot: P15382
RRID: AB_2838276

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(92%), Bovine(%), Horse(%), Sheep(%)
Clonality:
Polyclonal
Specificity:
KCNE1 Antibody detects endogenous levels of total KCNE1.
RRID:
AB_2838276
Cite Format: Affinity Biosciences Cat# DF6310, RRID:AB_2838276.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Delayed rectifier potassium channel subunit IsK; Human cardiac delayed rectifier potassium channel protein; IKs producing slow voltage gated potassium channel subunit beta Mink; IKs producing slow voltage-gated potassium channel subunit beta Mink; ISK; JLNS 2; JLNS; JLNS2; KCNE 1; KCNE1; KCNE1_HUMAN; LQT 5; LQT5; MGC33114; Minimal potassium channel; MinK; Potassium voltage gated channel Isk related family member 1; Potassium voltage gated channel Isk related subfamily member 1; Potassium voltage gated channel subfamily E member 1; Potassium voltage-gated channel subfamily E member 1;

Immunogens

Immunogen:

A synthesized peptide derived from human KCNE1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P15382 KCNE1_HUMAN:

Expressed in lung, kidney, testis, ovaries, small intestine, peripheral blood leukocytes. Expressed in the heart (PubMed:19219384). Not detected in pancreas, spleen, prostate and colon. Restrictively localized in the apical membrane portion of epithelial cells.

Description:
Voltage-gated potassium channels play a variety of important roles in human health and disease (1,2). KCNE1, also known as MinK, belongs to a family of small transmembrane proteins (KCNE1, 2, 3, 4, and KCNE1L) that modulate the activity of several voltage-gated K+ channels (3-5). KCNE1 functions as the modulatory β-subunit of the pore-forming α-subunit KCNQ1, and alters several biophysical properties of KCNQ1 channels (6,7). Research studies have shown that several inherited mutations in KCNE1 result in long QT syndrome (8-10) and deafness (11).
Sequence:
MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
92
Horse
91
Bovine
82
Sheep
82
Rabbit
73
Xenopus
60
Dog
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. Assembled with KCNQ1/KVLQT1 is proposed to form the slowly activating delayed rectifier cardiac potassium (IKs) channel. The outward current reaches its steady state only after 50 seconds. Assembled with KCNH2/HERG may modulate the rapidly activating component of the delayed rectifying potassium current in heart (IKr).

PTMs:

Phosphorylation inhibits the potassium current.

N-glycosylation at Asn-26 occurs post-translationally, and requires prior cotranslational glycosylation at Asn-5.

Subcellular Location:

Cell membrane>Single-pass type I membrane protein. Apical cell membrane. Membrane raft.
Note: Colocalizes with KCNB1 at the plasma membrane (By similarity). Targets to the membrane raft when associated with KCNQ1 (PubMed:20533308).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in lung, kidney, testis, ovaries, small intestine, peripheral blood leukocytes. Expressed in the heart. Not detected in pancreas, spleen, prostate and colon. Restrictively localized in the apical membrane portion of epithelial cells.

Family&Domains:

Belongs to the potassium channel KCNE family.

Research Fields

· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes.   (View pathway)

References

1). Association of the P441L KCNQ1 variant with severity of long QT syndrome and risk of cardiac events. Frontiers in cardiovascular medicine, 2022 (PubMed: 36386331) [IF=2.8]

Application: WB    Species: human    Sample: HEK293 cells

Figure 2. KCNQ1 P441L variant protein trafficking in the absence or presence of KCNE1 (potassium voltage-gated channel subfamily E regulatory subunit 1), and the interaction between the KCNQ1 P441L variant and KCNE1 proteins. (A–C) Representative confocal microscopy images and line plots showing the cellular distribution of wild-type and P441L variant KCNQ1 proteins in HEK293 cells. Scale bar, 10 μm. KCNQ1 was tagged with EGFP at the N-terminus and thus is shown as green fluorescence. Red fluorescence indicates the endoplasmic reticulum (ER); blue fluorescence, 4′,6-diamidino-2-phenylindole (DAPI), indicates cell nuclei. Line plots in panel (C) represent profiles plotted from left to right (L–R) to display the relative red and green fluorescence intensities obtained at the orange lines shown in the merged images. (D) Representative Western blot images showing fractionation assay results indicating that compared with the wild-type KCNQ1-EGFP (WT) protein level, the P441L-EGFP (P441L) protein level is significantly lower in the cell membrane but significantly increased in the cytoplasm. (E–G) Representative confocal microscopy images and line plots showing the cellular distribution of WT and P441L variant KCNQ1 proteins in HEK293 cells in the presence of KCNE1. Scale bar, 10 μm. HEK293 cells were transfected with KCNQ1-EGFP/KCNE1-mCherry (E), or P441L-EGFP/KCNE1-mCherry (F). Green fluorescence indicates KCNQ1; red fluorescence indicates KCNE1; and blue fluorescence, 4′,6-diamidino-2-phenylindole (DAPI), indicates cell nuclei. Line plots in panel (G) represent profiles plotted from left to right (L-R) to display the relative red and green fluorescence intensities obtained at the orange lines shown in the merged images. (H) Representative Western blot images showing fractionation assay results indicating that only a small amount of expressed P441L-EGFP protein is detected on the cell membrane when P441L-EGFP/KCNE1-mCherry are co-transfected into HEK293 cells. (I) Representative co-immunoprecipitation (IP) images showing KCNQ1 and KCNE1 proteins in lysates of HEK293 cells. In KCNQ1-EGFP/KCNE1-mCherry (WT) or P441L-EGFP/KCNE1-mCherry (MUT) expressed in HEK293 cells, the products of the IP showing KCNE1 pulled down by WT KCNQ1 or by the P441L variant. (J) Summary data showing the ratio of KCNE1 to WT KCNQ1 or the P441L variant pulled down IP products. WT represents KCNE1/KCNQ1; MUT, KCNE1/P441L variant. Data are shown as the mean ± SEM, n = 4, *P < 0.05, WT vs. MUT.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.