Product: LCN6 Antibody
Catalog: DF6336
Description: Rabbit polyclonal antibody to LCN6
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 18kDa; 18kD(Calculated).
Uniprot: P62502
RRID: AB_2838300

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
LCN6 Antibody detects endogenous levels of total LCN6.
RRID:
AB_2838300
Cite Format: Affinity Biosciences Cat# DF6336, RRID:AB_2838300.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Epididymal specific lipocalin 6; Epididymal specific lipocalin ELP16; Epididymal specific lipocalin LCN6; hLcn5; LCN5; Lipocalin 5; Lipocalin 6; MCG18768; UNQ643;

Immunogens

Immunogen:

A synthesized peptide derived from human LCN6, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P62502 LCN6_HUMAN:

Predominantly expressed in epididymis.

Description:
The Lipocalin family is composed of structurally conserved hydrophobic ligand binding proteins and is represented in all major taxonomic groups from prokaryotes to primates. Members of the lipocalin family are characterized by several common molecular-recognition properties: the ability to bind a range of small hydrophobic molecules, binding to specific cell-surface receptors and the formation of complexes with soluble macromolecules. Lipocalin-6, also known as LCN5, hLcn5, UNQ643 or LCN6, is a 163 amino acid protein that is predominantly expressed in epididymis. Lipocalin-6 locatizes to the head and tail of spermatozoa, with the highest concentration on the post-acrosomal region of the head. Belonging to the calycin superfamily, Lipocalin-6 may play a role in sperm maturation. The gene encoding Lipocalin-6 maps to human chromosome 9, which houses over 900 genes and comprises nearly 4% of the human genome.
Sequence:
MGGLLLAAFLALVSVPRAQAVWLGRLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLRTLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSRSLGFLSQ

Research Backgrounds

Function:

May play a role in male fertility.

Subcellular Location:

Secreted.
Note: Located on the head and tail of spermatozoa with the highest concentration on the post-acrosomal region of the head, where it appears aggregated into large patches.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Predominantly expressed in epididymis.

Family&Domains:

Belongs to the calycin superfamily. Lipocalin family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.