LCN6 Antibody - #DF6336
Product: | LCN6 Antibody |
Catalog: | DF6336 |
Description: | Rabbit polyclonal antibody to LCN6 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 18kDa; 18kD(Calculated). |
Uniprot: | P62502 |
RRID: | AB_2838300 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6336, RRID:AB_2838300.
Fold/Unfold
Epididymal specific lipocalin 6; Epididymal specific lipocalin ELP16; Epididymal specific lipocalin LCN6; hLcn5; LCN5; Lipocalin 5; Lipocalin 6; MCG18768; UNQ643;
Immunogens
- P62502 LCN6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGGLLLAAFLALVSVPRAQAVWLGRLDPEQLLGPWYVLAVASREKGFAMEKDMKNVVGVVVTLTPENNLRTLSSQHGLGGCDQSVMDLIKRNSGWVFENPSIGVLELWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSRSLGFLSQ
PTMs - P62502 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S14 | Phosphorylation | Uniprot | |
K51 | Methylation | Uniprot |
Research Backgrounds
May play a role in male fertility.
Secreted.
Note: Located on the head and tail of spermatozoa with the highest concentration on the post-acrosomal region of the head, where it appears aggregated into large patches.
Predominantly expressed in epididymis.
Belongs to the calycin superfamily. Lipocalin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.