GHRL Antibody - #DF6389
| Product: | GHRL Antibody |
| Catalog: | DF6389 |
| Description: | Rabbit polyclonal antibody to GHRL |
| Application: | WB IHC |
| Cited expt.: | IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep |
| Mol.Wt.: | 13kDa; 13kD(Calculated). |
| Uniprot: | Q9UBU3 |
| RRID: | AB_2838352 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6389, RRID:AB_2838352.
Fold/Unfold
Appetite regulating hormone; Ghrelin 27; Ghrelin 28; Ghrelin and obestatin prepropeptide; Ghrelin; Ghrelin/obestatin prepropeptide; ghrl; GHRL_HUMAN; Growth hormone releasing peptide; Growth hormone secretagogue; Growth hormone-releasing peptide; M46 protein; Motilin related peptide; Motilin-related peptide; MTLRP; Obestatin; Protein M46;
Immunogens
A synthesized peptide derived from human GHRL, corresponding to a region within C-terminal amino acids.
Highest level in stomach. All forms are found in serum as well. Other tissues compensate for the loss of ghrelin synthesis in the stomach following gastrectomy.
- Q9UBU3 GHRL_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation.
Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility (By similarity).
O-octanoylation or O-decanoylation is essential for ghrelin activity. The O-decanoylated forms Ghrelin-27-C10 and Ghrelin-28-C10 differ in the length of the carbon backbone of the carboxylic acid bound to Ser-26. A small fraction of ghrelin, ghrelin-28-C10:1, may be modified with a singly unsaturated carboxylic acid.
Amidation of Leu-98 is essential for obestatin activity.
Secreted.
Highest level in stomach. All forms are found in serum as well. Other tissues compensate for the loss of ghrelin synthesis in the stomach following gastrectomy.
Belongs to the motilin family.
Research Fields
· Environmental Information Processing > Signal transduction > cAMP signaling pathway. (View pathway)
References
Application: IHC Species: Rat Sample:
Application: IHC Species: Rat Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.