Product: MIF Antibody
Catalog: DF6404
Description: Rabbit polyclonal antibody to MIF
Application: WB IHC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus
Mol.Wt.: 12kDa(Observed); 12kD(Calculated).
Uniprot: P14174
RRID: AB_2838367

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(90%), Zebrafish(89%), Bovine(90%), Horse(90%), Sheep(90%), Rabbit(90%), Chicken(90%), Xenopus(90%)
Clonality:
Polyclonal
Specificity:
MIF Antibody detects endogenous levels of total MIF.
RRID:
AB_2838367
Cite Format: Affinity Biosciences Cat# DF6404, RRID:AB_2838367.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

GIF; GLIF; Glycosylation inhibiting factor; Glycosylation-inhibiting factor; L-dopachrome isomerase; L-dopachrome tautomerase; Macrophage migration inhibitory factor (glycosylation-inhibiting factor); Macrophage migration inhibitory factor; MIF; MIF protein; MIF_HUMAN; MMIF; Phenylpyruvate tautomerase;

Immunogens

Immunogen:

A synthesized peptide derived from human MIF, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Description:
Macrophage migration inhibitory factor, known as MIF or glycosylation-inhibiting factor, is a secreted, homotrimeric, pro-inflammatory cytokine that modulates macrophage and T cell function and is an important regulator of host response to infection. MIF is expressed at sites of inflammation, which suggests that it plays a role in regulating macrophage function in host defense. MIF is produced by the pituitary gland and is found in monocytes, macrophages, differentiating immunological cells in the eye lens and brain, and fibroblasts. Elevated levels of MIF protein are detected in the plasma of patients with severe sepsis or septic shock, a condition where MIF influences endotoxic shock by enhancing the production of other inflammatory cytokines including tumor necrosis factor (TNF ), interleukin-1 (IL-1) and interferon- (IFN- ). MIF promotes the systemic inflammatory response by counter-regulating glucocorticoid-mediated inhibition of immune-cell activation and proinflammatory cytokine production. MIF may mediate tissue destruction through the induction of proteinases.
Sequence:
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
90
Horse
90
Bovine
90
Sheep
90
Xenopus
90
Chicken
90
Rabbit
90
Zebrafish
89
Dog
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.

Subcellular Location:

Secreted. Cytoplasm.
Note: Does not have a cleavable signal sequence and is secreted via a specialized, non-classical pathway. Secreted by macrophages upon stimulation by bacterial lipopolysaccharide (LPS), or by M.tuberculosis antigens.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the MIF family.

Research Fields

· Metabolism > Amino acid metabolism > Tyrosine metabolism.

· Metabolism > Amino acid metabolism > Phenylalanine metabolism.

References

1). Allyl isothiocyanate mitigates airway inflammation and constriction in a house dust mite-induced allergic asthma model via upregulation of tight junction proteins and the TRPA1 modulation. Biomedicine & Pharmacotherapy, 2023 (PubMed: 37634475) [IF=6.9]

Application: WB    Species: Mouse    Sample:

Fig. 3. Effect of AITC on airway inflammation in HDM-induced asthma mice. Treat with AITC significantly decreased the level of (A) HDM-specific IgE, (B) IL-4, (C) IL-5, (D) IL-13 and (E) MIF. (F) Histology image of H&E stained lung sections and (G) mean inflammatory index for each sample in the same vision area is a measure of the severity of inflammation ranging from 0 to 3. The upper and lower vision areas are magnified at 200 × and 400 ×, respectively. Data are expressed in mean ± SEM (n = 5–10). Significant difference presented as different symbol. *p 

2). MIF aggravates experimental autoimmune prostatitis through activation of the NLRP3 inflammasome via the PI3K/AKT pathway. International immunopharmacology, 2024 (PubMed: 39153310) [IF=4.8]

3). MIF regulates T helper 17 cell differentiation by activating the p38 MAPK signaling pathway to drive the pathogenesis of EAP. International immunopharmacology, 2025 (PubMed: 40440956) [IF=4.8]

4). Macrophage migration inhibitory factor in inflammasome formation and macrophage recruitment by cervical squamous cell carcinoma cells. Oncology letters, 2025 (PubMed: 39944790) [IF=2.5]

5). Screening of immunosuppressive factors for biomarkers of breast cancer malignancy phenotypes and subtype-specific targeted therapy. PeerJ, 2022 (PubMed: 31293831) [IF=2.3]

Application: IHC    Species: human    Sample: breast

Figure 7 Immunohistochemical detection of the expression of MIF and VEGFA in a breast cancer tissue microarray. (A, D) Negative expression (-) in cancer-adjacent normal breast tissue.

6). Screening of Immunosuppressive Factors for Identifying Breast Cancer Malignant Phenotypes Using mRNA Microarray Datasets. , 2022

Application: IHC    Species: Human    Sample: breast cancer

Figure 3 Immunohistochemical detection of MIF (Row 1) and VEGFA (Row 2) in breast cancer tissue microarray.(a) and (D), Negative expression in Cancer adjacent normal breast tissue. (b) and (e), Negative expression in Invasive ductal carcinoma. (c) and (f), Positive expression in Invasive ductal carcinoma.

7). Migration Inhibition Factor Secreted by Peripheral Blood Memory B Cells Binding to CD74-CD44 Receptor Complex Drives Macrophage Behavior in Alzheimer's Disease. American journal of Alzheimer's disease and other dementias, 2024 (PubMed: 38491918)

Application: IF/ICC    Species: human    Sample:

Figure 3. Memory B Cells - Secreted MIF Conducts a Major Signal between Memory B Cells and Macrophages in AD. (A) VIN plot showing that MIF is mainly produced by Memory B Cells, and Macrophages significantly express the CD74-CD44 receptor complex. (B) Immunofluorescent imaging analysis demonstrating MIF expression on Memory B Cells. (C) Immunofluorescent imaging analysis revealing CD74-CD44 receptor complex expression on Macrophages. (D) The immunofluorescence semi-quantitative expression of macrophages and memory B cells. ***P < .001. (E) Double immunofluorescent staining showing co-localization of MIF and CD74-CD44 receptor complex proteins.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.